(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5100

AL939122.SCO5100     Location/Qualifiers
FT   CDS_pept        171010..171762
FT                   /transl_table=11
FT                   /gene="SCO5100"
FT                   /gene_synonym="SCBAC28G1.26"
FT                   /product="putative gntR-family regulatory protein"
FT                   /note="SCBAC28G1.26, possible gntR-family regulatory
FT                   protein, len: 250 aa; low similarity to SW:FARR_ECOLI
FT                   (EMBL:X15790) Escherichia coli fatty acid responsive
FT                   regulator (P30 protein) FarR, 240 aa; fasta scores: opt:
FT                   206 Z-score: 237.6 bits: 51.4 E(): 1.3e-05; 25.926%
FT                   identity in 243 aa overlap. Contains Pfam match to entry
FT                   PF00392 gntR, Bacterial regulatory proteins, gntR family"
FT                   /db_xref="GOA:Q93IY5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY5"
FT                   /protein_id="CAC44213.1"
FT                   /translation="MTFGEQPAYLRVAGDLRKKIADGLLPPHTRLPSQARIREEYGVSD
FT                   TVALEARKVLMAEGLVEGRSGSGTYVRERPVPRRVARSGYRPAGGATPFRQEQADGDAR
FT                   GTWESRSEQAEASGAVAERLGIKPGDRVMCTRYVFREAGEAVMLSTSWEPLDLTGRTPV
FT                   MLPEEGPLGGMGVVERMAAIDVVVDNVTEEVGARPGLAEELLALGGVPGHVVLVVQRTF
FT                   YASGRAVETADVVVPADRYRVAYHLPVR"
     gtgacattcg gtgagcagcc ggcgtatctg cgtgtcgcgg gtgatctccg caagaagatc        60
     gccgacggcc tgctgccgcc ccatacccgc ctcccgtccc aggcgcggat ccgcgaggag       120
     tacggggtct cggacaccgt cgccctggag gcccgcaagg tgctgatggc cgagggcctg       180
     gtcgagggcc gctccggttc cggcacctac gtgcgcgagc ggcccgtccc gcggcgcgtc       240
     gcccgctccg gataccggcc ggccggcggg gccacgccct tccgccagga gcaggccgac       300
     ggggacgcgc gcggcacctg ggagtcgcgc agcgagcagg ccgaggcgag cggtgccgtg       360
     gccgagcggc tcgggatcaa gcccggtgac cgggtgatgt gcacgcggta cgtcttccgg       420
     gaggccggtg aggccgtcat gctctccacc tcctgggagc cgctggacct gaccggccgc       480
     accccggtga tgctgcccga ggaagggccg ctcggcggga tgggtgtcgt ggagcggatg       540
     gccgccatcg acgtcgtcgt cgacaacgtc accgaggagg tcggcgcccg tcccggcctc       600
     gccgaggagt tgctcgccct gggcggcgtt ccgggacacg tggtgctggt cgtccagcgc       660
     acgttctacg cctcggggcg tgccgtggag accgccgacg tggtcgtccc ggccgaccgc       720
     taccgggtgg cgtaccacct gcccgtcagg tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page