(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5102

AL939122.SCO5102     Location/Qualifiers
FT   CDS_pept        172475..172909
FT                   /transl_table=11
FT                   /gene="SCO5102"
FT                   /gene_synonym="SCBAC28G1.28"
FT                   /product="putative mutT-like protein"
FT                   /note="SCBAC28G1.28, possible mutT-like protein, len: 144
FT                   aa; similar to SW:MUTT_ECOLI (EMBL:X04831) Escherichia coli
FT                   mutator MutT protein
FT                   (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.*)
FT                   MutT, 129 aa; fasta scores: opt: 190 Z-score: 228.6 bits:
FT                   48.1 E(): 4e-05; 33.333% identity in 132 aa overlap.
FT                   Contains Pfam match to entry PF00293 mutT, MutT-like domain
FT                   and match to Prosite entry PS00893 mutT domain signature"
FT                   /db_xref="GOA:Q93IY3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY3"
FT                   /protein_id="CAC44215.1"
FT                   /translation="MTERIVVGAALLDGGRLLAARRSAPAELAGRWELPGGKVEPGETP
FT                   EAALVRELREELGVAAEAGGRVPGQWPLRAPFVLQVWTARLRPGSAAPAPLEDHDELRW
FT                   LTPGQIWDVPWLDQDVPAVERVLAHLGLEAGTGRNGTGPG"
     atgacggaac ggatcgtggt gggcgccgcc ctgctcgacg gcgggcgcct gctcgccgcg        60
     cgccgcagcg cacccgccga actggccgga cggtgggagc tgcccggcgg caaggtcgag       120
     ccgggcgaga cgcccgaggc ggcgctcgta cgcgaactgc gcgaggaact cggggtggcg       180
     gccgaggccg gtgggcgcgt ccccgggcag tggcccctgc gggccccctt cgtcctccag       240
     gtgtggaccg cccgcctgcg ccccggctcc gcggcccccg cgcccctgga ggaccacgac       300
     gagctgcgct ggctgacccc cggccagatc tgggacgtgc cctggctcga ccaggacgta       360
     ccggccgtcg agcgggtgct cgcacacctg ggactcgagg cgggcaccgg gaggaacggt       420
     accgggcccg gataa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page