(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5103

AL939122.SCO5103     Location/Qualifiers
FT   CDS_pept        172948..173415
FT                   /transl_table=11
FT                   /gene="SCO5103"
FT                   /gene_synonym="SCBAC28G1.29"
FT                   /product="putative regulatory protein"
FT                   /note="SCBAC28G1.29, possible regulatory protein, len: 155
FT                   aa; similar to TR:Q53897 (EMBL:X60316) Streptomyces
FT                   coelicolor AbaA gene (putative regulator) or SCF42.12c, 192
FT                   aa; fasta scores: opt: 207 Z-score: 233.7 bits: 49.7 E():
FT                   2.1e-05; 41.270% identity in 126 aa overlap. Contains Pfam
FT                   match to entry PF02518 HATPase_c, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IY2"
FT                   /protein_id="CAC44216.1"
FT                   /translation="MGSSAGEVIGVKDGEGDCAEWVFPAAPDAVRTARSLVRRTLGEWR
FT                   LDSVGDIAALLVSELVTNALRHATGPIGVRLVRSPAPAAPAAGGAGGDGADGVLLVEVS
FT                   DPLPDPPRERVARPDDEDGRGLQLVASAARRWGTRPGEAGKTVWFELALPR"
     atggggtcgt cggccgggga agtgatcggc gtgaaggacg gcgagggcga ctgtgccgag        60
     tgggtctttc ccgcggcgcc ggacgccgtg cgcaccgccc gctccctggt ccgccgcacc       120
     ctgggcgagt ggcggctcga cagcgtcggg gacatcgccg ccctgctggt cagcgagctg       180
     gtcaccaacg ccctgcggca cgcgaccggc cccatcggcg tccgcctggt gcgcagcccc       240
     gccccggccg ccccggccgc cggaggcgcc ggaggcgacg gggccgacgg tgtcctgctg       300
     gtggaggtct ccgacccgct gccggacccg ccccgcgagc gcgtcgcccg tcccgacgac       360
     gaggacggcc ggggtctgca gttggtggcc tccgccgcac ggcgctgggg cacccgtccc       420
     ggggaggcgg gcaagaccgt gtggttcgaa ctcgccctgc cgcgctag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page