(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5105

AL939122.SCO5105     Location/Qualifiers
FT   CDS_pept        176599..177831
FT                   /transl_table=11
FT                   /gene="SCO5105"
FT                   /gene_synonym="SCBAC31E11.01"
FT                   /product="putative membrane protein"
FT                   /note="SCBAC31E11.01, possible membrane protein, len: 410
FT                   aa. Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="GOA:Q93IV0"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IV0"
FT                   /protein_id="CAC44312.1"
FT                   /translation="MADTEPGNTEPRSTEPGNTELRSTEPGSIEPGSTEPEAADGEDGP
FT                   PGPPASDDESGTGGAGGNRDAEGEAEATRRTRRRTRIRRTAVAVLLVLLVPLLTAETAL
FT                   RVNYMGDPADGTHTRNRDAMWLGHAWVDGRKDDADLAAFARRVKATGIRDLYVHTGPME
FT                   HDGTLPKSLYPRARWLVGAVHRELPGVRVQAFLGDVLATESPDGMRLEKPATRAAVVGS
FT                   ARQVLDVGYDGVHLDLEPLHSGDGDYLSLLDDVRAVTRARDAQLSVAAHQIDPLPGFHS
FT                   FWGTVAGHPKWWSQEFFGQVARRVDQIAVMSYDTMQPLESLYGGYVAQQTSLALEVTPP
FT                   TTHLLMGLPFYHENRFGHWNHAETVAAAVRGVRLGLSRTDADRERFGVAAYIDFAATEQ
FT                   DWASYRDGWVR"
     gtggcggaca cggaaccggg aaacaccgaa ccgagaagca ccgaaccggg aaacaccgaa        60
     ctgagaagca ccgaaccggg aagcatcgaa ccgggaagca ccgaaccgga agccgccgac       120
     ggcgaggacg ggccaccggg gccacccgca tccgacgacg aaagcggcac aggcggtgcg       180
     ggtgggaacc gggacgccga aggcgaagcc gaggcgaccc gacgaacacg ccgccgtacc       240
     cgcatccgcc ggacggccgt agccgtcctc ctggtcctgc tcgtccccct cctcaccgcc       300
     gagacagccc tccgcgtcaa ctacatgggc gaccccgccg acggcactca caccagaaac       360
     cgcgacgcga tgtggctcgg ccacgcgtgg gtcgacggcc gtaaggacga cgcggacctc       420
     gccgccttcg cccgccgcgt caaggcgacc ggcatccgcg acctgtacgt ccacaccggc       480
     ccgatggagc acgacggcac gctgccgaag tccctctacc ccagggcccg ctggctggtg       540
     ggcgccgtgc accgcgagct gcccggcgtc cgcgtccagg ccttcctcgg cgacgtcctc       600
     gccaccgaga gccccgacgg catgcgcctg gagaagcccg ccacccgcgc cgccgtcgtc       660
     ggctcggccc gccaggtcct ggacgtcggt tacgacggag tccacctgga cctggaaccg       720
     ctgcactcgg gcgacggcga ctacctctcg ctcctggacg acgtccgcgc cgtcacccgc       780
     gcccgtgacg cgcagctctc cgtcgccgcc caccagatcg acccgctgcc cggcttccac       840
     tccttctggg gcacggtcgc cggacacccc aagtggtggt cgcaggagtt cttcggccag       900
     gtcgcccgcc gcgtcgacca gatcgccgtc atgtcgtacg acacgatgca gccgctggag       960
     agcctgtacg gcggctacgt cgcccagcag acctcgctgg ccctggaggt caccccgccg      1020
     acgacccacc tcctgatggg cctgcccttc taccacgaga accgcttcgg ccactggaac      1080
     cacgcggaga ccgtcgccgc cgccgtccgc ggcgtccgcc tcggtttgtc ccgcacggac      1140
     gccgaccggg agaggttcgg cgtcgccgcg tacatcgact tcgcggcgac ggagcaggac      1200
     tgggcgtcgt accgggacgg ctgggtgcgc tag                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page