(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5106

AL939122.SCO5106     Location/Qualifiers
FT   CDS_pept        complement(177828..178607)
FT                   /transl_table=11
FT                   /gene="SCO5106"
FT                   /gene_synonym="SCBAC31E11.02c"
FT                   /gene_synonym="shdB2"
FT                   /product="putative succinate dehydrogenase iron-sulfur
FT                   subunit"
FT                   /note="SCBAC31E11.02c, shdB2, probable succinate
FT                   dehydrogenase iron-sulfur subunit, len: 259 aa; highly
FT                   similar to TR:AAK44479 (EMBL:AE006934) Mycobacterium
FT                   tuberculosis ferredoxin, 2Fe-2S MT0261, 248 aa; fasta
FT                   scores: opt: 1355 Z-score: 1588.1 bits: 301.4 E(): 7.7e-81;
FT                   74.900% identity in 251 aa overlap and to SW:DHSB_BACSU
FT                   (EMBL:M13470) Bacillus subtilis succinate dehydrogenase
FT                   iron-sulfur protein SdhB, 252 aa; fasta scores: opt: 365
FT                   Z-score: 434.1 bits: 87.9 E(): 1.4e-16; 30.603% identity in
FT                   232 aa overlap. Contains Pfam match to entry PF00111 fer2,
FT                   2Fe-2S iron-sulfur cluster binding domains"
FT                   /db_xref="GOA:Q93IU9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU9"
FT                   /protein_id="CAC44313.1"
FT                   /translation="MSGYEARFKVWRGDVAGGGLEDFTVEVNDGEVVLDIIHRLQATQA
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSVFTREETITVTPLRAFPVIRDLVTD
FT                   VGFNYTKAREVPAFVPPADLGPGEYRMMQEDVDRSQEFRKCIECFLCQDTCHVVRDHEE
FT                   NKPAFAGPRFLMRVAELDMHPLDAAGDTGLDRSRTAQDEHGLGFCNITKCCTEVCPEGI
FT                   RITDNALIPLKERAVDRKYDPLVWLGAKIGRRSRDTP"
     atgagcggtt acgaggcccg cttcaaggtg tggcgcggtg acgtggcggg cggtggcctc        60
     gaggacttca cggtcgaggt gaacgacggc gaggtggtcc tcgacatcat ccaccgcctc       120
     caggccaccc aggcccccga cctcgcggtg cgctggaact gcaaggcggg caagtgcggt       180
     tcgtgctcgg ccgagatcaa cgggcggccg cggctgctgt gcatgacccg catgtccgtc       240
     ttcacccgcg aggagacgat caccgtcacg ccgctgcgcg ccttcccggt gatccgggac       300
     ctggtgacgg acgtcggctt caactacacc aaggcccgcg aggtcccggc cttcgtgccg       360
     cccgccgacc tcgggccggg cgagtaccgg atgatgcagg aggacgtgga ccgctcgcag       420
     gagttccgca agtgcatcga gtgcttcctg tgccaggaca cctgccatgt cgtgcgggac       480
     cacgaggaga acaaacccgc cttcgcgggc ccgcgcttcc tcatgcgcgt cgccgagttg       540
     gacatgcacc cgctggacgc cgccggtgac accggcctgg accgctcgcg cacggcccag       600
     gacgagcacg gcctcggctt ctgcaacatc accaagtgct gcacggaggt gtgcccggag       660
     ggcatcagga tcacggacaa cgcgctgatc ccgttgaagg agcgggccgt cgaccgcaag       720
     tacgacccgc tggtctggct gggcgcgaag atcggccgcc ggtcccggga caccccctag       780
//

If you have problems or comments...

PBIL Back to PBIL home page