(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5107

AL939122.SCO5107     Location/Qualifiers
FT   CDS_pept        complement(178604..180565)
FT                   /transl_table=11
FT                   /gene="SCO5107"
FT                   /gene_synonym="SCBAC31E11.02c"
FT                   /gene_synonym="shdA2"
FT                   /product="putative succinate dehydrogenase flavoprotein
FT                   subunit"
FT                   /note="SCBAC31E11.03c, shdA2, probable succinate
FT                   dehydrogenase flavoprotein subunit, len: 653 aa; highly
FT                   similar to TR:AAK44480 (EMBL:AE006934) Mycobacterium
FT                   tuberculosis CDC1551 FAD flavoprotein oxidase, putative
FT                   MT0262, 646 aa; fasta scores: opt: 2941 Z-score: 3164.4
FT                   bits: 595.8 E(): 1.2e-168; 70.416% identity in 649 aa
FT                   overlap and to SW:DHSA_RICPR (EMBL:M88696) Rickettsia
FT                   prowazekii succinate dehydrogenase flavoprotein subunit (EC
FT                   1.3.99.1) SdhA, 596 aa; fasta scores: opt: 643 Z-score:
FT                   693.1 bits: 138.4 E(): 5.4e-31; 35.218% identity; in 619 aa
FT                   overlap. Contains Pfam matches to entries PF00890
FT                   FAD_binding_2, FAD binding domain and PF02910
FT                   succ_DH_flav_C, Fumarate reductase/succinate dehydrogenase
FT                   flavoprotein C-terminal domain and match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop"
FT                   /db_xref="GOA:Q93IU8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU8"
FT                   /protein_id="CAC44314.1"
FT                   /translation="MSVVDRQEWDVVVVGAGGAGLRAAVEARERGARTAVICKSLFGKA
FT                   HTVMAEGGIAASMGNVNSGDNWQVHFRDTMRGGKFLNQWRMAELHAQEAPQRVWELETW
FT                   GALFDRTKDGRISQRNFGGHEYPRLAHVGDRTGLELIRTLQQKIVSLQQEDFRETGDHE
FT                   SRLKVFQECTVTRLLQEDRKVSGVFGYERESGRFFVLQAPSVVIATGGIGKSFKVTSNS
FT                   WEYTGDGHALALLAGAPLLNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGR
FT                   RFMFDYVPDVFKEKYAESEAEGDRWYDDPDHNRRPPELLPRDEVARAINAEVKEGRGSP
FT                   HGGVFLDVSTRMPAEVIRRRLPSMYHQFKELADVDITAEAMEVGPTCHYVMGGIAVDSD
FT                   TAAARGVPGLFAAGEVAGGMHGSNRLGGNSLSDLLVFGRRAGRYAAEYAAGRTEEGTRA
FT                   RVDDAQVDAAAAEALRPFSAEAQEPGAGPPENPYTLHQELQQTMNDLVGIIRREAEMKQ
FT                   ALEKLAELRVRARRAGVEGHRQFNPGWHLALDLRNMLLVSECVARAALERTESRGGHTR
FT                   EDHPSMDRRWRPANLLCSLADPAGEAAGEAAATDPERGRIALERQTTEPIRPDLLALFD
FT                   KEELVKYLADEELEGRSE"
     atgtccgtgg tcgaccggca ggaatgggac gtcgtcgtgg tgggcgcggg cggtgccggg        60
     ctgcgcgccg ccgtcgaggc ccgcgagcgg ggcgcccgta cggccgtgat ctgcaagtcg       120
     ctgttcggca aggcgcacac ggtgatggcc gagggcggca tcgccgcctc catgggcaac       180
     gtcaactccg gggacaactg gcaggtccac ttccgcgaca ccatgcgcgg cggcaagttc       240
     ctcaaccagt ggcggatggc cgagctgcac gcccaggagg ccccgcagcg ggtgtgggag       300
     ctggagacct ggggcgcgct gttcgaccgg acgaaggacg gccggatctc gcagcgcaac       360
     ttcggcggcc acgagtaccc gcgcctcgcc cacgtcggcg accgcacggg cctggagctg       420
     atccgcaccc tccagcagaa gatcgtctcg ctccagcagg aggacttccg cgagaccggg       480
     gaccacgagt cccggctgaa ggtcttccag gagtgcacgg tcacccgcct gctccaggag       540
     gaccggaagg tctcgggggt cttcggctac gagcgcgaga gcggccgctt cttcgtcctc       600
     caggcgccct cggtggtgat cgcgacgggc ggcatcggca agtcgttcaa ggtgacgtcg       660
     aactcgtggg agtacaccgg cgacggccac gccctggcgc tgctggccgg ggcgccgctg       720
     ctcaacatgg agttcgtgca gttccacccg acgggcatgg tctggccgcc ctcggtgaag       780
     ggcatcctcg tcaccgagtc ggtgcgcggc gacggcgggg tgctgaggaa ctccgagggc       840
     aggcggttca tgttcgacta cgtcccggac gtcttcaagg agaagtacgc cgagtcggag       900
     gccgagggcg accgctggta cgacgacccg gaccacaacc ggcgcccgcc cgaactcctc       960
     ccccgcgacg aggtcgcccg cgcgatcaac gccgaggtga aggagggccg gggctcaccg      1020
     cacggcggcg tcttcctcga cgtgtcgacc cggatgcccg ccgaagtgat caggcgccgg      1080
     ctgccctcga tgtaccacca gttcaaggag ctggcggacg tggacatcac ggcggaggcg      1140
     atggaggtcg ggccgacctg ccactacgtg atgggcggca tcgccgtcga ctccgacacc      1200
     gccgccgccc gcggggtgcc gggactgttc gcggccggtg aggtggccgg cggcatgcac      1260
     ggctccaacc ggctgggcgg caactcgctg tccgacctgc tggtgttcgg gcggcgggcg      1320
     ggccggtacg cggccgagta cgcggcgggg cggacggagg agggcacccg cgcccgggtc      1380
     gacgacgccc aggtcgacgc ggccgccgcg gaggccctgc ggccgttctc cgccgaggcg      1440
     caggagcccg gcgcgggccc gccggagaac ccgtacaccc tccaccagga actccagcag      1500
     accatgaacg acctggtggg gatcatccgc cgcgaggcgg agatgaagca ggccctggag      1560
     aagctggcgg agctgcgggt gcgcgcccgc cgggccgggg tcgaggggca ccggcagttc      1620
     aacccgggct ggcacctcgc cctggacctg cgcaacatgc tgctggtcag cgaatgcgtg      1680
     gcgcgggccg cgctggagcg caccgagtcg cgcggcgggc acacccgtga ggaccatccg      1740
     tcgatggacc ggcgctggcg cccggccaac ctgctctgct cgctggccga cccggcgggc      1800
     gaggcagcgg gcgaggcggc ggcgacggac ccggagcgcg gccggatcgc cctggagcgg      1860
     cagaccaccg agcccatccg gcccgacctg ctcgccctct tcgacaagga ggagctggtg      1920
     aagtacctcg ccgacgagga actggagggc cggtccgaat ga                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page