(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5108

AL939122.SCO5108     Location/Qualifiers
FT   CDS_pept        complement(180582..181418)
FT                   /transl_table=11
FT                   /gene="SCO5108"
FT                   /gene_synonym="SCBAC31E11.04c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCBAC31E11.04c, possible integral membrane protein,
FT                   len: 278 aa; similar to TR:O53671 (EMBL:AL021929)
FT                   Mycobacterium tuberculosis hypothetical 31.1 kDa protein
FT                   MTV034.15c, 273 aa; fasta scores: opt: 1010 Z-score: 1230.3
FT                   bits: 235.4 E(): 6.5e-61; 54.545% identity in 275 aa
FT                   overlap. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q93IU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU7"
FT                   /protein_id="CAC44315.1"
FT                   /translation="MATGTEPPATEDRPPGGGVHTPTRAAIRARHLRTDRWWLAPAATA
FT                   AGLLAFVVYSTWRAFANADYYAAPYVSPFYSPCLAENCEPMRSGPNWELFGTWWGISPA
FT                   IIILIFPLGFRLTCYYYRKAYYRGFWASPPACAVAEPHRKYTGETRFPLILQNVHRYFF
FT                   YAALLVAGILSYDTVLAFRDEHYAWGHMGLGTLVFLANIALIWAYTLSCHSCRHIVGGK
FT                   LKHFSRHPVRYRMWQLVGRLNARHMQLAWASLVSVALADFYVYLVASGVFDDPRFF"
     gtggccactg gtaccgaacc gccagccacc gaagaccgtc ccccgggcgg tggcgtccac        60
     accccgacgc gtgccgccat ccgcgcccgg cacctgcgca ccgaccgctg gtggctggca       120
     ccggccgcca ccgccgcggg cctgctggcc ttcgtcgtct actcgacctg gcgggccttc       180
     gcgaacgccg actactacgc ggccccgtac gtctcgccct tctactcccc gtgtctggcg       240
     gagaactgcg agccgatgcg ctcggggccc aactgggagc tcttcggcac ctggtggggc       300
     atctcccccg cgatcatcat cctgatcttc ccgctcggct tccgcctgac ctgctactac       360
     taccgcaagg cctactaccg gggcttctgg gcctccccgc cggcctgcgc ggtggccgag       420
     ccgcaccgca agtacaccgg cgagacccgc ttcccgctga tcctgcagaa cgtccaccgg       480
     tacttcttct acgcggcgct cctggtcgcg ggcatcctca gctacgacac cgtgctcgcc       540
     ttccgcgacg agcactacgc ctggggccac atggggctcg gcaccctggt cttcctcgcc       600
     aacatcgcgc tgatctgggc gtacaccctg tcctgccact cctgccggca catcgtcggg       660
     ggcaagctca agcacttctc gcggcatccc gtgcgctacc ggatgtggca gctggtcggc       720
     cggctcaacg cccggcacat gcagctggcc tgggcgtccc tggtgagcgt ggcgctcgcc       780
     gacttctacg tgtacctggt cgcgtccggt gtcttcgacg atccgcgctt cttctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page