(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5110

AL939122.SCO5110     Location/Qualifiers
FT   CDS_pept        182093..184408
FT                   /transl_table=11
FT                   /gene="SCO5110"
FT                   /gene_synonym="SCBAC31E11.06"
FT                   /product="putative lipoprotein"
FT                   /note="SCBAC31E11.06, possible lipoprotein, len: 771 aa;
FT                   similar to SW:YC80_MYCTU (EMBL:Z77137) Mycobacterium
FT                   tuberculosis hypothetical 63.5 kDa protein MTCY50.02, 591
FT                   aa; fasta scores: opt: 565 Z-score: 501.6 bits: 103.2 E():
FT                   2.5e-20; 26.190% identity in 756 aa overlap. Contains
FT                   correctly situated match to Prosite entry PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site and
FT                   possible N-terminal region signal peptide sequence"
FT                   /db_xref="GOA:Q93IU5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU5"
FT                   /protein_id="CAC44317.1"
FT                   /translation="MSHVGVGPRAVMRAVAFLTTGVLAVPALAGCTSEDPAGKPLAEQD
FT                   VAAAARARISDGGTLRWAVDSVPDTLNAFQSDADATTTRVAQAVLPSMYRMDETGSPVR
FT                   NPDYLESAEVVDTEPKQVVVYKLNQQAVWSDGREIGAADFAAQWRALSGKDSAYWTARN
FT                   AGYDRIEKVERGANDLEVKVTFSRPYADWKALFTPLYPKDVTGTPDAFNDGARRALKVS
FT                   AGPFAVKKVDTKGDQVVLTGNPRWWGEPAKLDEIVLRAVPRDERVSELVAGKLDLAEID
FT                   PETADEVTLAAGPRDPATGTPLMGPGGTPAAGPQGRSAAEALRSWAIANGSDEEAAEEE
FT                   VLAREERGEAEAKARRRQQALSGFELRKSLEPAYTQLALNGAEGPLADERVRRAVARAL
FT                   DREELAEAVLKPLGLPAEPVGSHLALSGQPAYADGSGALGEQNAKEARALLADAGWVPG
FT                   GPVKKKDGEEAAGAEKDENKDEDKKDEEKSEGGDDGTYIVGEDDKNKDGKNKDGKNDDG
FT                   KNDDGGNDDGGNDDAGDAKDGADRESGEKHSSGKNTAQGGAPGAYAPKGTAAPAGAAAA
FT                   PLAKDGKELTLRFVLPSGPGSGTLRTVADRITDMLKEIGIGTRITKVPDESYFKDHIAA
FT                   GEYDLALYSWPASAFPATDARPIYAKPVPAADGSLNVAQNYTRVGTDQVDQLFDRALAT
FT                   LDQKESRDLLRKADSRIWAAAGSVPLYQRPQLTAARKNLANAGAFGFGTPVYEDMGFLK
FT                   KGAQGSRPTAPASPSPSS"
     atgtcccacg tcggcgtcgg accgcgcgcg gtcatgcgtg cggtcgcctt cctcaccacg        60
     ggcgtcctcg cggtccccgc gctggccggc tgcacctccg aggacccggc gggcaagccg       120
     ctggccgaac aggacgtcgc cgccgcggcc cgcgccagga tctccgacgg cggcaccctg       180
     cgctgggccg tggactccgt accggacacg ctgaacgcct tccagtcgga cgccgacgcc       240
     acgacgaccc gcgtcgcgca ggccgtgctg ccctcgatgt accggatgga cgagaccggc       300
     agccccgtgc gcaaccccga ctacctggag tcggccgagg tcgtcgacac cgagcccaag       360
     caggtcgtcg tctacaagct gaaccagcag gccgtctgga gcgacggccg ggagatcggc       420
     gccgcggact tcgccgccca gtggcgcgcc ctgtccggca aggacagcgc ctactggacc       480
     gcccgcaacg cggggtacga ccgcatcgag aaggtcgagc gcggtgcgaa cgacctggag       540
     gtcaaggtca ccttcagccg gccctacgcc gactggaagg ccctgttcac gcccctgtac       600
     ccgaaggacg tcacgggcac cccggacgcc ttcaacgacg gcgcgcggcg ggccctcaag       660
     gtcagcgccg ggcccttcgc ggtcaagaag gtcgacacca agggcgacca ggtggtcctc       720
     accggcaatc cccgctggtg gggcgagccg gcgaagctgg acgagatcgt gctgcgcgcc       780
     gtcccccgcg acgagcgggt ctccgaactg gtcgccggca agctcgacct cgccgagatc       840
     gacccggaga ccgccgacga ggtcaccctg gccgccggtc cccgggaccc cgccaccggc       900
     accccgctca tgggacccgg gggcaccccg gccgcgggcc cgcagggcag gtctgccgcc       960
     gaggcgctgc gctcctgggc catcgccaac ggctccgacg aggaggccgc cgaggaggag      1020
     gtcctcgccc gcgaggagcg cggcgaggcc gaggcgaagg cccggcgccg gcagcaggcc      1080
     ctgagcggct tcgagctccg caagtccctg gagcccgcct acacccagct cgccctcaac      1140
     ggcgccgaag gccccctcgc cgacgaacgc gtccgcaggg ccgtggcccg cgccctggac      1200
     cgcgaggagc tggccgaggc ggtgctcaag ccgctcggtc tgcccgccga gcctgtgggc      1260
     agccatctcg cgctctccgg ccagcccgcc tacgccgacg gcagcggcgc cctcggcgag      1320
     cagaacgcca aggaggcccg agccctgctc gcggacgccg gatgggttcc cggcggcccg      1380
     gtgaagaaga aggacggcga ggaggcggcc ggtgccgaga aggacgagaa caaggacgag      1440
     gacaagaagg acgaggagaa gtccgagggc ggcgacgacg gcacgtacat cgtcggcgag      1500
     gacgacaaga acaaggacgg caagaacaag gacggcaaga acgacgacgg caagaacgac      1560
     gacggcggga acgacgacgg cgggaacgac gacgccggcg acgccaagga cggcgccgac      1620
     cgggagagcg gcgagaagca cagcagcggc aagaacaccg cgcagggcgg cgcacccggc      1680
     gcctacgccc ccaagggcac cgcggccccg gccggcgcgg cggcggcccc gctcgccaag      1740
     gacggcaagg aactcaccct ccgcttcgtg ctcccctccg gtcccggctc cggcaccctg      1800
     cgcaccgtgg ccgaccgcat cacggacatg ctgaaggaga tcggcatcgg caccaggatc      1860
     accaaggtgc cggacgagag ctacttcaag gaccacatcg ccgccggcga gtacgacctg      1920
     gcgctctact cctggcccgc ctccgcgttc cccgccaccg acgcccgtcc catctacgcc      1980
     aagcccgtcc cggccgccga cggttccctg aacgtcgccc agaactacac ccgggtcggc      2040
     accgaccagg tcgaccagct cttcgaccgg gccctggcca ccctggacca gaaggagtcc      2100
     cgggacctgc tgcgcaaggc cgactcgcgg atctgggcgg cggccggctc cgttcccctc      2160
     taccagcgcc cccagctgac ggcggcccgc aagaacctcg ccaacgccgg cgccttcggg      2220
     ttcgggacac cggtctacga ggacatgggc ttcctcaaga agggtgccca gggctcccgg      2280
     cccaccgccc cggcctcgcc ctccccctcg tcctga                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page