(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5111

AL939122.SCO5111     Location/Qualifiers
FT   CDS_pept        184541..186448
FT                   /transl_table=11
FT                   /gene="SCO5111"
FT                   /gene_synonym="SCBAC31E11.07"
FT                   /product="putative GTP-binding protein"
FT                   /note="SCBAC31E11.07, possible GTP-binding protein, len:
FT                   635 aa; similar to SW:TYPA_ECOLI (EMBL:L19201) Escherichia
FT                   coli GTP-binding protein TypA/BipA (tyrosine phosphorylated
FT                   protein A) TypA or BipA or B3871, 591 aa; fasta scores:
FT                   opt: 915 Z-score: 968.6 bits: 189.3 E(): 2.5e-46; 48.039%
FT                   identity in 612 aa overlap. Contains Pfam match to entry
FT                   PF00009 GTP_EFTU, Elongation factor Tu family and matches
FT                   to Prosite entries PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and PS00301 GTP-binding elongation factors
FT                   signature"
FT                   /db_xref="GOA:Q93IU4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU4"
FT                   /protein_id="CAC44318.1"
FT                   /translation="MATRHDIRNVAIVAHVDHGKTTIVDGMLKQAGAFAAHQLEGVDDR
FT                   MMDSNDLEREKGITILAKNTAVKYHPKDGGDVITINIIDTPGHADFGGEVERGLSMVDG
FT                   VVLLVDASEGPLPQTRFVLRKALSQRLPIILCINKTDRPDARIDEVVNETYDLFLDLDA
FT                   DEEQIEFPIVYACGRDGVASLTKPEDGTVPSDSTSLEPFFSTILDHIPAPTYDEDAPLQ
FT                   AHVTNLDADNFLGRIALLRVHQGELKKGQTVAWMKRDGSVQNVRISELMMTEALTRKPA
FT                   EKAGPGDICAVAGIPDIMIGETLADVENPVPLPLITVDEPAISMTIGTNTSPLVGRGAT
FT                   GKGADNKAVVKDRKVTARQVKDRLDRELIGNVSLRVLDTERPDAWEVQGRGELALAILV
FT                   EQMRREGFELTIGKPQVVTKEVEGKTYEPVERMTIDVPEEHMGAVTQLMGVRKGRMDNM
FT                   SNHGSGWVRMEFVVPSRGLIGFRTEFLTQTRGTGIAHSIHEGHEPWFGTLTTRNNGSLV
FT                   ADRSGAVTAFAMTNLQERGVLFTDPGTEVYEGMIVGENSRADDMDVNITKEKKLTNMRS
FT                   SSADSFEAIVPPRKLSLEQSLEFCRDDECVEVTPEAVRIRKVNLDARERARAASRAKHG
FT                   "
     atggccacgc gccacgacat ccgcaacgtc gccatcgtcg cccacgtcga ccacggcaag        60
     accaccatcg tcgacggaat gctgaagcag gccggcgcct tcgccgcgca ccagctcgaa       120
     ggcgtcgacg accgcatgat ggactcgaac gacctggagc gtgagaaggg catcacgatc       180
     ctcgccaaga acacggcggt gaagtaccac ccgaaggatg gcggcgacgt catcaccatc       240
     aacatcatcg acacccccgg ccacgccgac ttcggcggcg aggtcgagcg cggtctgtcg       300
     atggtcgacg gtgtcgtgct gctcgtggac gcctccgagg gtccgctgcc gcagacccgg       360
     ttcgtgctgc gcaaggcgct cagccagcgg ctgccgatca tcctgtgcat caacaagacg       420
     gaccggccgg acgcccgcat cgacgaggtc gtcaacgaga cctacgacct cttcctcgac       480
     ctggacgccg acgaggagca gatcgagttc ccgatcgtct acgcctgcgg ccgggacggc       540
     gtcgcctccc tcaccaagcc cgaggacggc acggtcccct ccgactccac cagcctggag       600
     ccgttcttct cgacgatcct ggaccacatc ccggcgccga cctacgacga ggacgccccg       660
     ctccaggccc acgtcaccaa cctggacgcc gacaacttcc tcggccgcat cgcgctgctg       720
     cgcgtccacc agggcgagct gaagaagggc cagaccgtcg cctggatgaa gcgcgacggg       780
     tccgtgcaga acgtgcggat ctccgagctg atgatgacgg aggcgctcac ccgcaagccc       840
     gccgagaagg ccggccccgg tgacatctgc gcggtcgccg gcatcccgga catcatgatc       900
     ggcgagaccc tggccgacgt ggagaacccg gtcccgctgc cgctgatcac ggtggacgag       960
     cccgcgatct ccatgaccat cggcaccaac acctccccgc tggtcggccg cggcgccacc      1020
     ggcaagggcg ccgacaacaa ggcggtcgtc aaggaccgca aggtcaccgc ccgtcaggtc      1080
     aaggaccgcc tggaccgcga gctgatcggc aacgtctcgc tccgcgtcct ggacaccgag      1140
     cgccccgacg cctgggaggt gcagggccgc ggtgagctgg cgctggccat cctggtcgag      1200
     cagatgcgcc gggagggctt cgagctgacc atcggcaagc cgcaggtcgt caccaaggag      1260
     gtcgagggca agacgtacga gcccgtcgag cggatgacga tcgacgtgcc cgaggagcac      1320
     atgggcgcgg tcacgcagct catgggcgtg cgcaagggcc ggatggacaa catgtccaac      1380
     cacggctcgg gctgggtccg catggagttc gtggtcccct cccgcggcct gatcggattc      1440
     cggacggagt tcctcaccca gacccgcggc accggcatcg cgcactccat ccacgagggc      1500
     cacgagccct ggttcggcac cctcacgaca cgtaacaacg gctcgctggt cgccgaccgc      1560
     tcgggtgccg tcaccgcgtt cgcgatgacc aacctccagg agcgcggtgt gctcttcacg      1620
     gaccccggca ccgaggtgta cgagggcatg atcgtcggcg agaactcccg cgccgacgac      1680
     atggacgtga acatcaccaa ggagaagaag ctcaccaaca tgcggtcgtc ctcggccgac      1740
     tcgttcgagg cgatcgtccc gccgcgcaag ctctccctgg agcagtccct ggagttctgc      1800
     cgcgacgacg agtgcgtcga ggtgaccccc gaggccgtcc ggatccgcaa ggtgaacctg      1860
     gacgcccgcg agcgcgcccg cgccgccagc cgcgccaagc acggctga                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page