(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5113

AL939122.SCO5113     Location/Qualifiers
FT   CDS_pept        188498..190300
FT                   /transl_table=11
FT                   /gene="SCO5113"
FT                   /gene_synonym="bldKB"
FT                   /gene_synonym="SCBAC31E11.09"
FT                   /product="BldKB, putative ABC transport system lipoprotein"
FT                   /note="SCBAC31E11.09, bldKB, possible ABC transport system
FT                   lipoprotein, len: 600 aa; almost identical to TR:P72407
FT                   (EMBL:U68036) Streptomyces coelicolor BldKB, 602 aa.
FT                   Contains 4x Pfam matches to entry PF00496 SBP_bac_5,
FT                   Bacterial extracellular solute-binding proteins, family 5,
FT                   match to Prosite entry PS00017 ATP/GTP-binding site motif A
FT                   (P-loop) and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Also contains possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="GOA:Q93IU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU2"
FT                   /protein_id="CAC44320.1"
FT                   /translation="MSILRNRTATAAIVAVAAGALTLTACGGGDSDSSAKDNSKKKEDA
FT                   KSQSKPVQIGDAQASTGPAPEVPGAKPGGTMTVYQTADFSHLDPGQIYVSDGKLLGRLI
FT                   FRGLTQYDEDENGNLTVVGDLATDAGKQTDGGKTWTYTLKDNLKDANGNPINSADIRHT
FT                   IERMYSSYITDGPTYLQQWLSGDGTTYRDAYAGPDKGKHLPDNVLETPDDKTIVFHFKT
FT                   ARPDLPQMLTMPGYSVVPEETDTKEKYDSAPVAAGPYKIAEFKPGKSMKLVKNTQWDPK
FT                   SDSVRHQYVDGFNIEMNHDDEDQTKTLLADQGGAKNAMMFTGQVATTQLQKVVGDKDAM
FT                   KNRTIQGYAPYVWQLNFNMNRVKDKKLRDAITLALPSDSVFKADGGAYGGEVANSLMSP
FT                   TTPGYDEAFDPFGRAKKPNGDIEAAKKLIKEGGFEGKSLVYAYANTPERQKQAVLISTA
FT                   LEKIGLDIQKKEIDSATWYEQVGKVDNGLDLYMTGWGQDWPSASTVIPPVYDGKQIQDG
FT                   ASNYSHINDDHVNSEIQRIQQITDTAEATKAWAELNEYISKEVNPAAPIYYTKVFQIFG
FT                   SNVGGIRYSSDSSYVDVTRVFLKK"
     atgagcattc tccgtaaccg caccgccacg gccgccatag tcgcggtcgc agccggcgcc        60
     ctgaccctca ccgcctgcgg tggtggcgac agcgacagct ccgccaagga caacagcaag       120
     aagaaggaag acgccaagtc gcagtcgaag ccggtccaga tcggcgacgc gcaggcgtcc       180
     accggcccgg cccccgaggt cccgggcgcc aagccgggcg gcaccatgac cgtctaccag       240
     acggcggact tctcccacct ggacccgggc cagatctacg tctcggacgg caagctgctc       300
     ggccgcctca tcttccgcgg tctgacccag tacgacgagg acgagaacgg caacctgacc       360
     gtcgtgggcg acctcgccac cgacgcgggc aagcagaccg acggcggcaa gacctggacg       420
     tacaccctca aggacaactt gaaggacgcc aacggcaacc cgatcaactc ggcggacatc       480
     cgccacacga tcgagcggat gtactccagc tacatcaccg acggcccgac gtacctccag       540
     cagtggctgt ccggcgacgg caccacctac cgcgacgcct acgcgggtcc ggacaagggc       600
     aagcacctgc ccgacaacgt cctggagacg ccggacgaca agacgatcgt cttccacttc       660
     aagacggctc gccccgacct cccgcagatg ctgaccatgc ccggttacag cgtcgtcccg       720
     gaggagacgg acaccaagga gaagtacgac tccgcgcccg tcgccgccgg tccgtacaag       780
     atcgccgagt tcaagcccgg caagtcgatg aagctggtca agaacaccca gtgggacccg       840
     aagtccgact cggtgcgcca ccagtacgtc gacggcttca acatcgagat gaaccacgac       900
     gacgaggacc agaccaagac cctcctcgcc gaccagggtg gcgccaagaa cgccatgatg       960
     ttcaccggcc aggtcgccac gacgcagctc cagaaggtcg tcggcgacaa ggacgcgatg      1020
     aagaaccgca cgatccaggg ctacgcgccc tacgtgtggc agctcaactt caacatgaac      1080
     cgcgtcaagg acaagaagct ccgcgacgcc atcaccctgg ccctgccctc cgactcggtc      1140
     ttcaaggccg acggcggtgc ctacggcggt gaggtcgcca actcgctgat gtcgcccacc      1200
     accccgggct acgacgaggc gttcgacccg ttcggccgcg ccaagaagcc gaacggcgac      1260
     atcgaggccg ccaagaagct catcaaggaa ggcggcttcg agggcaagag cctcgtctac      1320
     gcctacgcca acacccctga gcggcagaag caggccgtcc tgatctccac cgccctggag      1380
     aagatcggtc tcgacatcca gaagaaggag atcgactccg ccacctggta cgagcaggtc      1440
     ggcaaggtcg acaacgggct ggacctctac atgaccggct ggggccagga ctggccgtcc      1500
     gcctccacgg tcatcccgcc ggtctacgac ggcaagcaga tccaggacgg tgcgtcgaac      1560
     tactcgcaca tcaacgacga ccacgtcaac tccgagatcc agcgcatcca gcagatcacg      1620
     gacacggcgg aggccaccaa ggcctgggcg gagctgaacg agtacatctc caaggaagtg      1680
     aacccggccg ccccgatcta ctacaccaag gtcttccaga tcttcggttc gaacgtcggc      1740
     ggcatccgct acagctcgga ctcgagctac gtggacgtga cccgggtctt cctcaagaag      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page