(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5114

AL939122.SCO5114     Location/Qualifiers
FT   CDS_pept        190414..191391
FT                   /transl_table=11
FT                   /gene="SCO5114"
FT                   /gene_synonym="bldKC"
FT                   /gene_synonym="SCBAC31E11.10"
FT                   /product="BldKC, putative ABC transport system integral
FT                   membrane protein"
FT                   /note="SCBAC31E11.10, bldKC, possible ABC transport system
FT                   integral membrane protein, len: 325 aa; almost identical to
FT                   previously sequenced TR:P72408 (EMBL:U68036) Streptomyces
FT                   coelicolor BldKC, 323 aa. Contains Pfam match to entry
FT                   PF00528 BPD_transp, Binding-protein-dependent transport
FT                   systems inner membrane component. Also contains possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q93IU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU1"
FT                   /protein_id="CAC44321.1"
FT                   /translation="MLQFLIRRSFGAVLILVLISAFTFFMFFAIPQDPAMLACGKNCTP
FT                   DALEIIHKNLGLDQPVTVQYWHFLAGIFTGRDFAVGHCDAPCFGVSFANNQNVWDTILD
FT                   RFPLTVSLTVGSLIVFLIVGLGAGLLAAKNRGTWIDKVFSSGSLVVSSLQIYFLGPLVL
FT                   LALVYSTGWLQKPKYVPISEDAAGWFAGLLIPWIVMATIFTANYTRMSRSSMIEQLQEE
FT                   HVRAARAKGMSSNYTFFRYAWRGSLVPIVTILGIDLSALMGGGMVTEMTFGLAGIGRLA
FT                   LESVINKDLPMLMGVMLVSAALIIVFNLIVDAMYAVIDPRVRLS"
     atgcttcaat tcctcattcg ccggtccttc ggcgcggtgc tgatcctggt gttgatcagt        60
     gccttcacct tcttcatgtt cttcgcgatc ccgcaggacc cggccatgct ggcctgtggc       120
     aagaactgca ctccggacgc gctggagatc atccacaaga acctgggcct cgaccagccg       180
     gtcacggtcc agtactggca tttcctggcg ggcatcttca ccgggcgcga cttcgcggtc       240
     ggtcactgcg acgccccctg cttcggcgtc tccttcgcga acaaccagaa cgtctgggac       300
     acgatcctcg accgcttccc gctgaccgtc tcgctgaccg tcggttccct gatcgtcttc       360
     ctcatcgtcg gcctcggcgc cggcctgctg gccgccaaga accgcggcac ctggatcgac       420
     aaggtgttca gctccggctc gctggtcgtc agctccctgc agatctactt cctcggcccg       480
     ctcgtcctgc tcgcgctcgt ctacagcacc ggctggctgc agaagcccaa gtacgtgccg       540
     atctccgagg acgccgccgg ctggttcgcc ggcctgctga tcccctggat cgtcatggcg       600
     accatcttca ccgccaacta cacccgtatg agccggtcgt cgatgatcga gcaactacag       660
     gaagagcatg tgagggcggc ccgtgccaag ggcatgtcga gcaactacac cttcttccgc       720
     tacgcctggc gcggctcgct cgtgcccatc gtcaccatcc tcggcatcga cctgtccgcg       780
     ctgatgggcg gcggcatggt gaccgagatg accttcggcc tggccggcat cggccggctc       840
     gcgctggagt cggtgatcaa caaggacctg ccgatgctga tgggcgtcat gctggtcagc       900
     gccgcgctca tcatcgtctt caacctgatc gtggacgcca tgtacgcagt catcgacccg       960
     cgcgtgcgcc tgtcctag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page