(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5115

AL939122.SCO5115     Location/Qualifiers
FT   CDS_pept        191402..192463
FT                   /transl_table=11
FT                   /gene="SCO5115"
FT                   /gene_synonym="bldKD"
FT                   /gene_synonym="SCBAC31E11.11"
FT                   /product="BldKD, putative ABC transporter intracellular
FT                   ATPase subunit"
FT                   /note="SCBAC31E11.11, bldKD, putative ABC transporter
FT                   intracellular ATPase subunit, len: 353 aa; almost identical
FT                   to previously sequenced TR:P72409 (EMBL:U680360)
FT                   Streptomyces coelicolor BldKD putative ABC transporter
FT                   intracellular ATPase subunit, 353 aa and similar to
FT                   TR:O86574 (EMBL:AL031184) Streptomyces coelicolor
FT                   SC2A11.13, 366 aa; fasta scores: opt: 1427 Z-score: 1344.1
FT                   bits: 257.3 E(): 3.8e-69; 60.340% identity in 353 aa
FT                   overlap. Contains Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter and match to Prosite entry PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and PS00211 ABC
FT                   transporters family signature"
FT                   /db_xref="GOA:Q93IU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IU0"
FT                   /protein_id="CAC44322.1"
FT                   /translation="MTTQTKPEEAPAAAAGDAFLSVRDLKVHFSTEGGVVKAVDGLSFD
FT                   LERGKTLGIVGESGSGKSVTNLAVLGLHDRRRTAIDGSITLDGQELTDASEKQLEKLRG
FT                   KKMAMIFQDALTALSPYYTVGRQIAEPFMKHNGASKKDARVRAIDLLQKVGIPHPQKRV
FT                   DDYPHQFSGGMRQRAMIAMALSCNPDLLIADEPTTALDVTVQAQILDLLKDLQQEFGSA
FT                   IIMITHDLGVVGNMADDIMVMYAGRAVERGTVREVLKSPQHPYTWGLLSSMPNLTSDVD
FT                   EPLMPIPGSPPSLMNPPSGCAFHPRCGFTDLVSGERCSGERPTLPHGRAAACHLTGDQR
FT                   QQVFIEKIQPRLG"
     gtgaccactc agaccaagcc cgaagaggcc ccggccgccg ccgcggggga cgcgtttctc        60
     tcggtgcgcg acctcaaggt ccacttctcc accgagggcg gcgtcgtcaa ggcggtggac       120
     ggtctctcct tcgacctgga gcggggcaag accctcggca tcgtcggcga gtccggctcc       180
     ggcaagtcgg tgaccaacct ggccgtcctc ggcctgcacg accgccgcag gaccgccatc       240
     gacggatcga tcacgctgga cggccaggag ctgaccgacg ccagtgagaa gcagctggag       300
     aagctgcgcg gcaagaagat ggcgatgatc ttccaggacg cgctgaccgc gctgtcgccg       360
     tactacacgg tcggccggca gatcgcggag ccgttcatga agcacaacgg cgcgtccaag       420
     aaggacgccc gggtgcgcgc catcgacctg ctgcagaagg tcggcatccc gcacccgcag       480
     aagcgggtcg acgactaccc gcaccagttc tccggcggta tgcgccagcg cgccatgatc       540
     gccatggccc tgtcctgcaa cccggacctg ctgatcgcgg acgagcccac cacggcgctc       600
     gacgtgaccg tccaggcgca gatcctcgac ctgctcaagg acctccagca ggagttcggc       660
     tccgcgatca tcatgatcac ccacgacctg ggcgtggtcg gcaacatggc cgacgacatc       720
     atggtcatgt acgcgggccg ggccgtggag cgcggcacgg tgcgcgaggt gctcaagtcc       780
     ccgcagcacc cgtacacctg gggtctgctg agctcgatgc cgaacctcac gtccgacgtc       840
     gacgagccgc tgatgccgat cccggggtcg ccgccctcgc tgatgaaccc gccctccggg       900
     tgcgcgttcc acccgcggtg cggcttcacc gacctggtct ccggcgagcg ttgctcgggg       960
     gagcgtccga cgctcccgca cggccgtgcc gccgcctgcc acctgacggg agaccagcgg      1020
     cagcaggtgt tcatcgagaa gattcagccc cggctgggct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page