(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5116

AL939122.SCO5116     Location/Qualifiers
FT   CDS_pept        192491..193636
FT                   /transl_table=11
FT                   /gene="SCO5116"
FT                   /gene_synonym="SC9E12.01"
FT                   /gene_synonym="bldKE"
FT                   /gene_synonym="SCBAC31E11.12"
FT                   /product="putative peptide transport system ATP-binding
FT                   subunit"
FT                   /note="SC9E12.01, probable peptide transport system
FT                   ATP-binding protein (fragment), len: >142 aa; similar to
FT                   SW:OPPF_ECOLI (EMBL:AE000223) Escherichia coli oligopeptide
FT                   transport protein ATP-binding protein OppF, 334 aa; fasta
FT                   scores: opt: 344 z-score: 423.0 E(): 4.3e-16; 56.5%
FT                   identity in 92 aa overlap and to TR:O86575 (EMBL:AL031184)
FT                   Streptomyces coelicolor oligopeptide ABC transporter
FT                   ATP-binding protein SC2A11.14, 496 aa; fasta scores: opt:
FT                   488 z-score: 576.6 E(): 1.7e-26; 56.6% identity in 136 aa
FT                   overlap"
FT                   /note="SCBAC31E11.12, bldKE, putative ABC transporter
FT                   intracellular ATPase subunit (fragment), len: >272 aa;
FT                   almost identical to previously sequenced TR:P72410
FT                   (EMBL:U68036) Streptomyces coelicolor putative ABC
FT                   transporter intracellular ATPase subunit (fragment) BldKE,
FT                   284 aa and similar to N-terminal region of TR:O86575
FT                   (EMBL:AL031184) Streptomyces coelicolor SC2A11.14, 497 aa;
FT                   fasta scores: opt: 1186 Z-score: 1170.6 bits: 225.2 E():
FT                   1.7e-59; 63.603% identity in 272 aa overlap. Contains Pfam
FT                   match to entry PF00005 ABC_tran, ABC transporter and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00211 ABC transporters family
FT                   signature"
FT                   /db_xref="GOA:Q8CJS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS2"
FT                   /protein_id="CAD55223.1"
FT                   /translation="MSDNSKTTTAVADDFPQQRDGDTAPLLKVSGLSKHFPIKGGFPIK
FT                   RTVGHVKAVDGVDFEVFPGESLGLVGESGCGKSTTGRLLTRLYEPTQGSIEYRGKDITR
FT                   ANRRELAPVRSEIQMIFQDPYASLNPRQTVGTIISGPMEINGINPPGGREKRVRELLEI
FT                   VGLNPEHYNRFPHEFSGGQRQRIGVARAVALQPKLIVADEPVSALDVSIQAQVVNLLQE
FT                   VQREMGIAFVFIAHDLAIVRHFSQRVAVMYLGKIVEIADRDSLYNRPRHPYTHALLSAV
FT                   PETDLDAEKRERIRLEGDVPSPISPPSGCRFRTRCWKAQDKCATEEPPLVQLSGNREGH
FT                   LTACHFPEEGSTEARAEDIVMDPGLKAMEDGADGGATLSKG"
     atgagcgaca acagcaagac gaccacagcg gtggccgacg acttcccgca gcagcgggac        60
     ggcgacaccg cgccgcttct caaggtcagc ggcctctcga agcacttccc gatcaagggc       120
     ggcttcccga tcaagcgcac cgtcggccac gtcaaggccg tcgacggcgt tgatttcgag       180
     gtcttcccgg gcgagagcct cggcctcgtc ggcgagtccg gctgcggcaa gtcgaccacc       240
     ggccggctgc tgacccggct gtacgagccg acccagggca gcatcgagta ccggggcaag       300
     gacatcaccc gggccaaccg gcgggaactg gcgccggtcc ggtccgagat ccagatgatc       360
     ttccaggacc cgtacgcgtc cctgaacccg cggcagaccg tcggcacgat catctcgggc       420
     ccgatggaga tcaacgggat caacccgccc ggcggccggg agaagcgcgt ccgcgagctc       480
     ctggagatcg tcggtctcaa cccggagcac tacaaccgct tcccgcacga gttctccggc       540
     ggccagcggc agcgcatcgg ggtggcgcgc gccgtcgcgc tgcagccgaa gctcatcgtc       600
     gccgacgagc cggtctcggc cctcgacgtg tcgatccagg cccaggtggt gaacctgctg       660
     caggaggtgc agcgggagat gggcatcgcg ttcgtcttca tcgcccacga cctggcgatc       720
     gtgcggcact tctcgcagcg cgtcgcggtg atgtacctgg gcaagatcgt ggagatcgcg       780
     gaccgcgact cgctctacaa ccgcccccgt cacccgtaca cgcacgcgct gctgtcggcc       840
     gtgccggaga cggacctcga cgccgagaag cgggagcgga tccggctcga gggcgacgtg       900
     ccctcgccga tctcgccgcc ctccggctgc cggttccgca cccggtgctg gaaggcgcag       960
     gacaagtgcg ccaccgagga gccgccgctg gtgcagctct ccgggaaccg ggagggccac      1020
     ctgacggcct gccacttccc cgaggagggc tcgacggagg ccagggccga ggacatcgtc      1080
     atggacccgg gtctgaaggc gatggaggac ggcgccgacg gcggcgcgac cctctccaag      1140
     ggctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page