(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5117

AL939122.SCO5117     Location/Qualifiers
FT   CDS_pept        193836..195470
FT                   /transl_table=11
FT                   /gene="SCO5117"
FT                   /gene_synonym="SC9E12.02"
FT                   /product="putative peptide transport system secreted
FT                   peptide-binding protein"
FT                   /note="SC9E12.02, possible peptide transport system
FT                   secreted peptide-binding protein, len: 544 aa; similar to
FT                   SW:OPPA_BACSU (EMBL:X56347) Bacillus subtilis
FT                   oligopeptide-binding protein OppA precursor, 545 aa; fasta
FT                   scores: opt: 648 z-score: 642.6 E(): 2.5e-28; 26.1%
FT                   identity in 552 aa overlap and to TR:P72407 (EMBL:U68036)
FT                   Streptomyces coelicolor SpoOKA homologue BldKB, 602 aa;
FT                   blastp scores: Score = 165 (58.1 bits), Expect = 2.9e-10,
FT                   Sum P(2) = 2.9e-10; Identities = 116/502 (23%), Positives =
FT                   202/502 (40%). Contains 2x Pfam matches to entry PF00496
FT                   SBP_bac_5, Bacterial extracellular solute-binding proteins,
FT                   family 5 and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Also contains possible N-terminal region signal
FT                   peptide sequence"
FT                   /db_xref="GOA:Q9F353"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F353"
FT                   /protein_id="CAC05747.1"
FT                   /translation="MRGATHARWAACAAAVALAATACGGGGGDGGSGGGSGGVLSSSWG
FT                   DPQNPLEPANTNEVQGGKVLDMIFRGLKKYDPGTGEAQNMLAEKIDTSDSQNFTVTVKD
FT                   GWTFSNGEKVTAQSFVDAWNYGASLKNNQRNAYFFAYIDGYDKVHPESGSQSTDTLSGL
FT                   KVTGPRTFTIKLSQKFSTFPDTLGYPAFAPLPKAFFDDHDAWLKKPVGNGPYQVDNYTR
FT                   GSQMSLRKWDDYPGPDKAQNGGVDLKVYTDNNTAYTDLIAGNLDLVDDVPASQLKNVKN
FT                   DLGDRYINTPAGIIQTLAFPFYDNDWNKSGSEKVRKGLSMAIDRKQITDTIFQNTRTPA
FT                   TDWTSPVLGKDGGYKPGLCGDACEYNAAEAKKLVKEGGGLPGGQVKITYNADTGSHKQW
FT                   VDAVCNSINNALDNDRACAGNPVGTFADFRNQITNQKMSGPFRAGWQMDYPLIQNFLQP
FT                   LYYTNASSNDGKWSSKKFDDLVDQANAETDTAKAVGLFQQAEEVLRDDMGAIPLWYQNG
FT                   SAGYSDRLSNVKLNPFSVPVYNEIKVG"
     atgcgcggag ccacgcacgc cagatgggcc gcttgcgcgg cggcggtagc cctcgcggcg        60
     acggcctgcg gcggcggggg cggggacgga ggcagcggcg gcggcagcgg cggcgtgctc       120
     agctcctcct ggggcgaccc ccagaacccg ctggagccgg ccaacaccaa cgaggtgcag       180
     ggcggcaagg tcctcgacat gatcttccgg gggctgaaga agtacgaccc cgggaccggc       240
     gaggcgcaga acatgctcgc cgagaagatc gacacctccg actcgcagaa cttcaccgtc       300
     accgtcaagg acggctggac cttcagcaac ggcgagaagg tcaccgcgca gtccttcgtg       360
     gacgcctgga actacggcgc gagcctgaag aacaaccagc gcaacgcgta cttcttcgcc       420
     tacatcgacg gctacgacaa ggtgcacccc gaaagcggct cgcagagcac cgacacgctc       480
     tcggggctga aggtgaccgg cccccgcacc ttcacgatca agctcagcca gaagttctcc       540
     acgttccccg acaccctcgg ctatccggcc ttcgcgccgc tgcccaaggc gttcttcgac       600
     gaccacgacg cctggctgaa gaagcccgtc ggcaacggcc cctaccaggt cgacaactac       660
     acccgcggct cccagatgtc cctgcgcaag tgggacgact accccggccc ggacaaggcg       720
     cagaacggcg gcgtggacct caaggtctac accgacaaca acaccgccta caccgacctg       780
     atcgcgggca acctcgacct cgtcgacgac gtcccggcct cccagctcaa gaacgtcaag       840
     aacgacctcg gcgaccggta catcaacacc ccggcgggca tcatccagac cctcgccttc       900
     ccgttctacg acaacgactg gaacaagtcc ggctcggaga aggtccgcaa gggcctgtcc       960
     atggcgatcg accgcaagca gatcaccgac accatcttcc agaacacccg caccccggcc      1020
     accgactgga cctcaccggt cctcggcaag gacggcggct acaagccggg cctgtgcggg      1080
     gacgcctgcg agtacaacgc cgcggaggcc aagaagctgg tcaaggaggg cggcggactc      1140
     cccggcgggc aggtcaagat cacctacaac gccgacaccg gctcccacaa gcagtgggtc      1200
     gacgcggtct gcaactccat caacaacgcc ctggacaacg accgcgcctg cgccgggaac      1260
     ccggtcggca ccttcgccga cttccgcaac cagatcacca accagaagat gagcggcccc      1320
     ttccgcgcgg gctggcagat ggactacccg ctcatccaga acttcctcca gccgctgtac      1380
     tacaccaacg cctcctccaa cgacggcaag tggtccagca agaagttcga cgacctcgtc      1440
     gaccaggcca acgccgagac cgacaccgcc aaggccgtcg gcctcttcca gcaggccgag      1500
     gaggtcctca gggacgacat gggggccatc ccgctctggt accagaacgg cagcgcaggc      1560
     tactccgacc ggctctccaa cgtgaagctc aacccgttca gcgtcccggt ctacaacgag      1620
     atcaaggtcg gctga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page