(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5119

AL939122.SCO5119     Location/Qualifiers
FT   CDS_pept        196459..197376
FT                   /transl_table=11
FT                   /gene="SCO5119"
FT                   /gene_synonym="SC9E12.04"
FT                   /product="putative peptide transport system integral
FT                   membrane protein"
FT                   /note="SC9E12.04, probable peptide transport system
FT                   integral membrane protein, len: 305 aa; similar to
FT                   SW:OPPC_BACSU (EMBL:X56347) Bacillus subtilis oligopeptide
FT                   transport system permease protein OppC, 305 aa; fasta
FT                   scores: opt: 670 z-score: 745.0 E(): 0; 35.5% identity in
FT                   296 aa overlap and to TR:P72406 (EMBL:U68036) Streptomyces
FT                   coelicolor SpoOKB homologue BldKA, 335 aa; blastp scores:
FT                   Score = 382 (134.5 bits), Expect = 9.1e-41, Sum P(2) =
FT                   9.1e-41; Identities = 88/231 (38%), Positives = 134/231
FT                   (58%). Contains Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component and possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9F351"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F351"
FT                   /protein_id="CAC05749.1"
FT                   /translation="MDLGASEAVTLEQPPGPDGADPRDKPRSLWTDAWHDLRRNPVFII
FT                   SALVIIFLIVISIWPSLIASGSPLKCDLAKAQEGSQPGHPFGFNGQGCDVYTRTVYGAR
FT                   TSVAVGILATLGVALLGSVLGGLAGFFGGGGDAVLSRITDIFFAIPVVLGGLVLLSVIT
FT                   SNTIWPVIGFIVLLGWPQISRIARGSVITAKQNDYVQAARALGASNSRLLLRHIAPNAV
FT                   APVIVVATIALGTYISLEATLSFLGVGLKPPSVSWGIDISSAAPYVRNAPHALLWPSGA
FT                   LAITVLAFIMLGDAVRDALDPKLR"
     atggacctcg gcgccagcga ggcggtcacg ctggagcagc cgccgggccc ggacggggcc        60
     gacccccggg acaaaccccg cagcctgtgg accgacgcct ggcacgacct gcgccgcaac       120
     cccgtcttca tcatctcggc gctggtgatc atcttcctga tcgtcatctc catctggccg       180
     tcgctgatcg cctccggcag ccccctcaag tgcgacctgg ccaaggccca ggaaggctcc       240
     cagcccggcc accccttcgg cttcaacggc cagggctgcg acgtctacac ccgcaccgtc       300
     tacggcgccc gcacctcggt cgcggtcggc atcctggcca ctctcggcgt cgccctcctc       360
     ggcagcgtcc tcggcggcct cgccgggttc ttcggcggcg gcggggacgc ggtcctgtcc       420
     cggatcaccg acatcttttt cgcgatcccg gtcgtcctgg gcggcctcgt cctgctctcc       480
     gtcatcacca gcaacaccat ctggccggtc atcggcttca tcgtgctgct cggctggcca       540
     cagatctccc gcatcgcccg cggctccgtc atcaccgcca aacagaacga ctacgtgcag       600
     gcggcgcggg cgctgggcgc ctccaactcc cggctcctgc tgcgccacat cgcgcccaac       660
     gccgtcgcgc ccgtcatcgt cgtggcgacc atcgcgctcg gcacctacat ctccctggag       720
     gcgaccctgt ccttcctcgg cgtcggcctg aagccgccca gcgtctcctg gggcatcgac       780
     atctcctccg ccgcccccta cgtgcgcaac gccccgcacg cgctgctgtg gccgtccggg       840
     gcgctcgcca tcaccgtcct cgcgttcatc atgctcggcg acgcggtgcg cgacgccctc       900
     gacccgaagc tgaggtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page