(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5120

AL939122.SCO5120     Location/Qualifiers
FT   CDS_pept        197385..198368
FT                   /transl_table=11
FT                   /gene="SCO5120"
FT                   /gene_synonym="SC9E12.05"
FT                   /product="putative peptide transport system ATP-binding
FT                   protein"
FT                   /note="SC9E12.05, probable peptide transport system
FT                   ATP-binding protein, len: 327 aa; similar to SW:OPPD_BACSU
FT                   (EMBL:X56347) Bacillus subtilis oligopeptide transport
FT                   system ATP-binding protein OppD, 358 aa; fasta scores: opt:
FT                   1126 z-score: 1167.7 E(): 0; 53.9% identity in 310 aa
FT                   overlap, to TR:P72409 (EMBL:U68036) Streptomyces coelicolor
FT                   putative ABC transporter intracellular ATPase subunit
FT                   BldKD, 353 aa; fasta scores: opt: 1035 z-score: 1074.2 E():
FT                   0; 51.5% identity in 326 aa overlap and to TR:O86574
FT                   (EMBL:AL031184) Streptomyces coelicolor oligopeptide ABC
FT                   transporter ATP-binding protein SC2A11.13, 365 aa; fasta
FT                   scores: opt: 1097 z-score: 945.2 E(): 0; 52.3% identity in
FT                   331 aa overlap. Contains Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and matches to Prosite entries
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) and PS00211
FT                   ABC transporters family signature"
FT                   /db_xref="GOA:Q9F350"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F350"
FT                   /protein_id="CAC05750.1"
FT                   /translation="MLLEVRDLHVEFHTRDGVAKAVNGVSYGVDAGETLAVLGESGSGK
FT                   SVTAQTIMGILDIPPGRVTAGEILFEGRDLLKLKEEERRKVRGAEMAMIFQDALSSLNP
FT                   VLTVGAQLAEMFTVHRGMSRKDAHAKAVELMDRVRIPAAKERVRQYPHQFSGGMRQRIM
FT                   IAMAMALEPKLIIADEPTTALDVTVQAQVMDLLAELQRELHMGLILITHDLGVVADVAD
FT                   KIAVMYAGRIVETAPVHDIYKAPAHPYTRGLLESIPRLDQKGQELYAIKGLPPNLTRIP
FT                   PGCAFHPRCPMAQDVCRTDVPPLYDVTESDAERGSACHFWRECLHG"
     atgctgctcg aagtgcgcga cctgcacgtg gagttccaca cccgcgacgg tgtcgccaag        60
     gccgtcaacg gcgtcagcta cggcgtggac gcgggcgaga ccctcgcggt gctcggcgag       120
     tccggatccg gcaagtccgt caccgcccag acgatcatgg gcatcctcga catcccgccg       180
     ggcagggtca ccgcggggga gatcctcttc gagggccgcg acctgctgaa gctgaaggag       240
     gaggaacgcc ggaaggtccg cggcgccgag atggcgatga tcttccagga cgcgctgtcc       300
     tcgctgaacc cggtcctgac cgtcggcgcc cagctcgccg agatgttcac cgtgcaccgc       360
     ggcatgtccc gcaaggacgc ccacgccaag gccgtcgagt tgatggaccg ggtccgcatc       420
     ccggccgcga aggagcgggt gcggcagtac ccgcaccagt tctccggcgg gatgcgccag       480
     cgcatcatga tcgcgatggc gatggccctg gagcccaagc tgatcatcgc cgacgagccg       540
     accaccgccc tcgacgtcac cgtccaggcc caggtcatgg acctgctcgc ggaactccag       600
     cgcgaactgc acatgggcct gatcctcatc acccacgacc tcggcgtggt cgccgacgtc       660
     gccgacaaga tcgccgtcat gtacgccggc cggatcgtcg agacggcacc cgtccacgac       720
     atctacaagg ccccggccca cccgtacacc cgcggcctgc tggagtcgat cccgcgcctg       780
     gaccagaagg gccaggagtt gtacgccatc aagggcctgc cgcccaacct gacccggatc       840
     ccgccaggct gcgccttcca cccccgctgc ccgatggccc aggacgtctg ccgcaccgac       900
     gtacctcccc tctacgacgt caccgagtcc gacgccgagc ggggcagcgc ctgccacttc       960
     tggagggagt gcctgcatgg ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page