(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5121

AL939122.SCO5121     Location/Qualifiers
FT   CDS_pept        198361..199431
FT                   /transl_table=11
FT                   /gene="SCO5121"
FT                   /gene_synonym="SC9E12.06"
FT                   /product="putative peptide transport system ATP-binding
FT                   protein"
FT                   /note="SC9E12.06, probable peptide transport system
FT                   ATP-binding protein, len: 356 aa; similar to SW:APPF_BACSU
FT                   (EMBL:U20909) Bacillus subtilis oligopeptide transport
FT                   ATP-binding protein AppF, 329 aa; fasta scores: opt: 1255
FT                   z-score: 1332.6 E(): 0; 57.3% identity in 335 aa overlap,
FT                   to TR:P72410 (EMBL:U68036) Streptomyces coelicolor putative
FT                   ABC transporter intracellular ATPase subunit BldKE
FT                   (fragment), 284 aa; fasta scores: opt: 999 z-score: 1063.6
FT                   E(): 0; 58.1% identity in 260 aa overlap and to TR:O86575
FT                   (EMBL:AL031184) Streptomyces coelicolor oligopeptide ABC
FT                   transporter ATP-binding protein SC2A11.14, 496 aa; fasta
FT                   scores: opt: 1306 z-score: 1117.3 E(): 0; 55.4% identity in
FT                   345 aa overlap. Contains Pfam match to entry PF00005
FT                   ABC_tran, ABC transporter and matches to Prosite entries
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) and PS00211
FT                   ABC transporters family signature"
FT                   /db_xref="GOA:Q9F349"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F349"
FT                   /protein_id="CAC05751.1"
FT                   /translation="MAETTEPILEVRGLVKHYPLTSGILFKKQVGAVKAVDGVDFRLAR
FT                   GETLGIVGESGCGKSTVAKMLVNLERPTAGEIRYKGEDITRLSGRALKSVRRNIQMVFQ
FT                   DPYTSLNPRMTVGDIIGEAYDIHPEVAPKGDRRRRVQDLLDVVGLNPEYINRYPHQFSG
FT                   GQRQRIGIARGLALRPEIIVADEPVSALDVSVQAQVINLMARLQDEFDLSYIFIAHDLS
FT                   IVRHISDRVGVMYLGRIVETGRDEEIYDHPTHPYTQALLSAVPVPDPEAREHRERIILS
FT                   GDVPSPTNIPSGCRFRTRCWKARERCALEVPALAVPAEFRSVSGPAAHDSACHFAEEKQ
FT                   VVPPEGEGEGEGSGPG"
     atggctgaga ccacggagcc gatcctcgaa gtccgcggcc tggtcaagca ctacccgctg        60
     acttccggca tcctcttcaa gaagcaggtc ggcgcggtca aggccgtcga cggcgtggac       120
     ttccggctgg cccgcggcga gacgctcggc atcgtcggcg agtccggctg cggcaagtcc       180
     acggtcgcca agatgctggt caacctggag cggccgacgg cgggggagat ccgctacaag       240
     ggcgaggaca tcacccgcct gtcgggccgg gccctgaagt ccgtacgccg gaacatccag       300
     atggtcttcc aggaccccta cacctccctc aacccccgca tgaccgtcgg cgacatcatc       360
     ggcgaggcct acgacatcca ccccgaggtg gccccgaagg gcgaccggcg gcgacgggtc       420
     caggacctgc tggacgtggt cggcctgaac ccggagtaca tcaaccgcta cccccaccag       480
     ttctccggcg gccagcgcca gcgcatcggc atcgcgcggg gcctggcgct gcgcccggag       540
     atcatcgtcg ccgacgaacc ggtctcggcc ctcgacgtgt cggtccaggc ccaggtgatc       600
     aacctgatgg cccggctcca ggacgagttc gacctctcgt acatcttcat cgcccacgac       660
     ctgtcgatcg tccggcacat ctcggaccgg gtcggcgtga tgtacctggg ccgcatcgtc       720
     gagaccggcc gggacgagga gatctacgac caccccacgc atccctacac ccaggcgctg       780
     ctgtccgccg taccggtgcc cgacccggag gcccgggaac accgcgagcg gatcatcctg       840
     tccggcgacg tgccgtcccc gaccaacatc ccctcggggt gccgcttccg cacccgctgc       900
     tggaaggcgc gggagcggtg cgcgctggag gtaccggccc tggccgttcc cgccgagttc       960
     cgctcggtct ccgggcccgc ggcgcacgac tccgcctgcc acttcgcgga ggagaagcag      1020
     gtggtgccgc ccgagggcga gggcgagggc gagggcagcg ggccggggtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page