(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5122

AL939122.SCO5122     Location/Qualifiers
FT   CDS_pept        complement(199564..201687)
FT                   /transl_table=11
FT                   /gene="SCO5122"
FT                   /gene_synonym="SC9E12.07c"
FT                   /product="putative peptidase"
FT                   /note="SC9E12.07c, probable peptidase, len: 707 aa; similar
FT                   to TR:P95782 (EMBL:D83263) Xanthomonas maltophilia
FT                   dipeptidyl peptidase IV, 741 aa; fasta scores: opt: 442
FT                   z-score: 478.1 E(): 3.7e-19; 33.2% identity in 733 aa
FT                   overlap. Contains Pfam matches to entries PF00930
FT                   DPPIV_N_term, Dipeptidyl peptidase IV (DPP IV) N-terminal
FT                   region and PF00326 Peptidase_S9, Prolyl oligopeptidase
FT                   family and match to Prosite entry PS00708 Prolyl
FT                   endopeptidase family serine active site"
FT                   /db_xref="GOA:Q9F348"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F348"
FT                   /protein_id="CAC05752.1"
FT                   /translation="MTTESDSFPKRHARTQRFTLGAPRSFTVAPDGSRVAFLRSGTGTD
FT                   RANSLWVLDAEKGGERMAADPRALLGGAQERLSPEERARRERSREGGAGIVGYATDSSV
FT                   ELASFALSGRLFVAELQVGTARELPTPGPVIDPRPSPDGRHVAYVAQGALRVVGAEGDG
FT                   DRALAEADGEGVTYGLAEFVAAEEMSRSRGFWWSPESDRLLVARVDDTPVQRWWISDPA
FT                   HPGRDPQHVPYPAAGTPNADVRLFVVGLDGGRTEVLWDRARYPYLARVHWSAAGAPLLL
FT                   VQARDQRSQLFLAVDTESGTTRMVHADEDPIWLELFPGVPYWSPSGQLVRIADEGGARV
FT                   LAVGERLLTGAQLHLRAVLDVGADDVLVSASAGEEAAEAEIGEVHVYRVNELGVERLSQ
FT                   EPGVHSAVRAGGVTVLVSATLDRPGARVRVLRDGKAAATIASYAEDPGLSPRVTLTQGG
FT                   ARRVPCAVLMPTDYHGDTPLPVLLDPYGGPHGQRVVAAHNAHLTSQWFADQGFAVVVAD
FT                   GRGTPGRSPAWEKAVKDDVAAVVLQDQVDALHALAADFPLDLDRVAVRGWSFGGYLAAL
FT                   AALRRPDVFHAAVVGAPVTDLRLYDTHYQERYLGDPGEQPDVYRRNSVIDDAGLVDAAE
FT                   PHRPMMVIHGLADDNVVVAHSLRLSSALLAAGRPHEVLPLSGVTHMTPQESVAENLLRL
FT                   QVDFLKRSLPAPA"
     atgacgaccg agtccgactc cttccccaaa cggcacgccc gcacccagcg gttcacgctc        60
     ggcgcgccgc gttcgttcac cgtggcaccc gatggttcac gggtcgcctt cctgcgctcc       120
     ggtaccggta cggaccgggc caattcgctg tgggtgctcg acgccgagaa gggcggggag       180
     cgcatggccg ccgacccccg cgcccttctg ggcggcgctc aggaacggct gtcccccgag       240
     gaacgggccc ggcgcgagcg cagccgcgag ggcggcgccg ggatcgtcgg ctacgccacc       300
     gactcgtcgg tcgagctggc ctctttcgcc ttgtcagggc ggctcttcgt ggccgagctg       360
     caggtcggca ccgcgcgcga actgcccacc cccgggccgg tgatcgaccc gcgcccctcc       420
     cccgacggcc ggcacgtcgc ctacgtcgcc cagggcgccc tgcgcgtggt gggcgccgag       480
     ggggacgggg acagggccct ggccgaggcg gacggcgagg gcgtcacgta cgggctcgcc       540
     gagttcgtgg cggccgagga gatgtcgcgc agccggggct tctggtggag cccggagtcg       600
     gaccgcctgc tggtcgcccg cgtggacgac acgccggtcc agcgctggtg gatctccgac       660
     ccggcccatc ccgggcgtga tccacaacac gtgccgtacc cggcggcggg cacccccaac       720
     gcggacgtac ggctgttcgt ggtcggtctc gacggggggc gcacggaggt cctgtgggac       780
     cgggcgcggt atccgtatct ggcgcgagtg cactggtcag ccgcgggtgc gccgctgctt       840
     ctcgtacagg cgcgcgacca gcgcagccag ctgttcctgg cggtggacac cgagtcgggg       900
     acgacccgga tggtgcacgc cgacgaagat ccaatttggc tggaactctt ccccggggtg       960
     ccctactgga gcccctcggg ccaactcgtg cggatcgccg acgagggcgg tgcgcgggtg      1020
     ctcgcggtgg gcgaacgact gctcaccggg gcccagttgc acctgcgggc ggtgctggac      1080
     gtcggcgccg acgacgtgct ggtctccgcc tcggcgggcg aggaggcggc cgaggcggag      1140
     atcggcgagg tgcacgtcta ccgggtgaac gaactgggcg tcgaacgcct gtcgcaggag      1200
     cccggtgtgc actcggcggt acgcgccggg ggcgtgacgg tgctcgtctc cgcgaccctc      1260
     gaccggccgg gagcccgagt acgggtactg cgggacggga aggccgcggc gaccatcgcc      1320
     tcgtatgcgg aagaccccgg tttgtccccg cgcgtgaccc tcacccaggg gggcgcacga      1380
     cgcgtcccgt gcgccgtgct tatgccaacg gactaccacg gtgacacccc cctcccggtc      1440
     ctcctggacc cctacggtgg tccgcacggt cagcgcgtcg tggccgcgca caacgcccac      1500
     ctcacctcgc agtggttcgc ggaccagggg ttcgcggtgg tcgtcgccga cgggcggggc      1560
     actccggggc gctcccccgc ctgggagaag gccgtcaagg acgacgtggc cgctgtggtg      1620
     ctccaggacc aggtcgacgc gctgcacgcc ctcgccgccg acttcccgct ggacctggac      1680
     cgcgtcgccg tccgggggtg gtccttcggc ggctatctcg ccgccctcgc ggcgctgcgc      1740
     cggccggacg tcttccacgc cgccgtcgtg ggcgccccgg tcaccgacct caggctctac      1800
     gacacccact accaggagcg gtacctcggc gaccccggtg agcagccgga cgtctaccgc      1860
     cgcaactcgg tgatcgacga cgccggactg gtcgacgccg ccgagccgca ccggcccatg      1920
     atggtcatcc acggcctcgc ggacgacaac gtggtggtcg cccactcgct gcgcctgtcc      1980
     tcggccctgc tggcggccgg ccgcccgcac gaggtgctgc ccctgtccgg cgtcacccac      2040
     atgactccgc aggagtcggt cgccgagaac ctgctgcggc tccaggtgga cttcctcaag      2100
     cggtcgctgc ccgccccggc gtga                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page