(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5124

AL939122.SCO5124     Location/Qualifiers
FT   CDS_pept        complement(202058..202264)
FT                   /transl_table=11
FT                   /gene="SCO5124"
FT                   /gene_synonym="SC9E12.09c"
FT                   /product="hypothetical protein"
FT                   /note="SC9E12.09c, hypothetical protein, len: 68 aa;
FT                   similar to TR:Q9RDR5 (EMBL:AL136500) Streptomyces
FT                   coelicolor hypothetical 7.7 kDa protein SC1G2.14c, 73 aa;
FT                   fasta scores: opt: 217 z-score: 327.7 E(): 8.7e-11; 55.9%
FT                   identity in 59 aa overlap"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F346"
FT                   /protein_id="CAC05754.1"
FT                   /translation="MIRTSSSTGLVWSKSSYSSGGETDSCVEVALAPGTVHVRDSKNLP
FT                   DTGPRLALAPEAWGCFVAGTVRS"
     atgatccgca cgtcctcgtc cacaggactg gtgtggtcca agagcagcta cagcagcggt        60
     ggggaaacgg actcctgcgt cgaggtcgcc ctcgcccccg gcaccgtcca cgtccgcgac       120
     tcgaagaacc tgccggacac cggcccccgg ctcgcgctgg cgccggaggc ctggggctgc       180
     ttcgtggccg gcacggtcag aagttga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page