(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5125

AL939122.SCO5125     Location/Qualifiers
FT   CDS_pept        complement(202261..203124)
FT                   /transl_table=11
FT                   /gene="SCO5125"
FT                   /gene_synonym="SC9E12.10c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SC9E12.10c, hypothetical protein, len: 287 aa;
FT                   similar to TR:Q9RDR4 (EMBL:AL136500) Streptomyces
FT                   coelicolor hypothetical 31.7 kDa protein SC1G2.15c, 284 aa;
FT                   fasta scores: opt: 1240 z-score: 1466.1 E(): 0; 67.2%
FT                   identity in 287 aa overlap"
FT                   /db_xref="GOA:Q9F345"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F345"
FT                   /protein_id="CAC05755.1"
FT                   /translation="MSVDAGTDQVDEPGWEVDPDDDWALAVIATVGRQLRLRREAAGMR
FT                   APDFAVAIGYGEDLVYKVEGGRRIPRPEYLDRADEVLTAGGLVAAMKEDVKKVRYPKKV
FT                   RDLAQMEARAVELQLYDPVNVHGLLQTPDYARALFRMRRPRYAEDEIERGVAARTARKA
FT                   VFERDPAPELGFVQDEWTLRRRLGGTDVVRRQLEHLLMLGRLPNVEIQVMPMDREEHAG
FT                   VDGAIEVLKFEDGTAVGRSPGVANGRPVTDLRQVRILELRYGIIRAQALTPCESAAFIE
FT                   QLLGET"
     atgtcggtgg acgccgggac ggaccaggtc gacgaaccgg ggtgggaggt ggatccggac        60
     gacgactggg ccctggccgt gatcgccacg gtggggcggc agctccggct gcgccgggag       120
     gcggcgggga tgcgggctcc cgacttcgcg gtggcgatcg ggtacgggga ggacctcgtg       180
     tacaaggtcg agggcggcag gcggatcccg cgccccgagt acctggacag ggcggacgag       240
     gtgctgaccg ccggtgggct cgtcgcggcc atgaaggagg acgtgaagaa ggtccggtac       300
     ccgaagaagg tgcgggatct cgcgcagatg gaggcgcggg cggtggagct ccagctgtac       360
     gacccggtga acgttcacgg actcctgcag acgcccgact acgcccgagc actgtttcgc       420
     atgcgacgac ctcgttacgc ggaggacgag atcgagcggg gcgtggctgc gcgtacagct       480
     cgcaaagccg tcttcgagcg cgacccggcg cctgaactcg gtttcgtgca ggacgagtgg       540
     acgctccgac ggcggctcgg gggaacggac gtggtacgac ggcaactgga acacctgctg       600
     atgctcgggc gactgccgaa cgtcgagatc caggtgatgc cgatggaccg cgaggagcac       660
     gccggggtgg acggtgccat cgaggtcctg aagttcgagg acggcacggc ggtcggtcgc       720
     tcgccgggtg ttgccaacgg ccgcccggtg accgacctca ggcaggtccg tatcctcgaa       780
     ctacggtatg gcatcatccg ggcgcaggcc ctcaccccgt gtgagtcggc cgccttcatc       840
     gagcaactgc tgggggagac atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page