(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5127

AL939122.SCO5127     Location/Qualifiers
FT   CDS_pept        204160..204582
FT                   /transl_table=11
FT                   /gene="SCO5127"
FT                   /gene_synonym="SC9E12.12"
FT                   /product="putative integral membrane protein"
FT                   /note="SC9E12.12, possible integral membrane protein, len:
FT                   1450 aa. Contains possible hydrophobic membrane spanning
FT                   regions"
FT                   /db_xref="GOA:Q9F343"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F343"
FT                   /protein_id="CAC05757.1"
FT                   /translation="MNGRNEPPSSALAQPLRPPSLGRAALYAGLFVLGAVLGVAGALLQ
FT                   PAWFPGGLLLALAAEAGLCAGAGRAVGRRGGAVAPALGWALAVVLLTTSRPEGDFLFAA
FT                   GAGSYLFLLGGIAVAVICATLAPVRQPDGGPARLRK"
     gtgaacggcc gcaacgaacc gccgagctcc gcactcgccc agccgctgcg cccgccctcg        60
     ctcggacggg ccgccctgta cgccgggctc ttcgtgctcg gcgccgtcct cggagtggcg       120
     ggtgcgctgc tccagccggc ctggttcccg ggcgggctgc tgctcgcgct ggccgccgag       180
     gcggggctgt gtgccggggc gggccgtgcc gtcgggcgcc ggggaggggc cgtcgcgccc       240
     gccctcggct gggcgctcgc cgtggtgctg ctcaccacca gccgtccgga gggcgacttc       300
     ctcttcgccg ccggtgccgg ctcctatctc ttcctgctcg gcgggatcgc cgttgctgtg       360
     atctgtgcca ccctcgcgcc ggtgcggcaa ccggacggcg gccccgcccg acttcgcaag       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page