(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5130

AL939122.SCO5130     Location/Qualifiers
FT   CDS_pept        208165..208905
FT                   /transl_table=11
FT                   /gene="SCO5130"
FT                   /gene_synonym="SC9E12.15"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="SC9E12.15, possible ABC transporter integral
FT                   membrane protein, len: 246 aa; similar to TR:CAB88184
FT                   (EMBL:AL352972) Streptomyces coelicolor putative ABC
FT                   transporter integral membrane protein SCC30.14, 238 aa;
FT                   fasta scores: opt: 516 z-score: 611.2 E(): 1.4e-26; 35.9%
FT                   identity in 237 aa overlap. Contains possible hydrophobic
FT                   membrane spanning regions"
FT                   /db_xref="GOA:Q9F340"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F340"
FT                   /protein_id="CAC05760.1"
FT                   /translation="MNGLIKLELTRALRNRKFLFFSVIYPSALFLLIAGSADATSEVDG
FT                   TGLTLPTFFMVSMASFGALTAVLMGNSERIAKERESGWVRQLRLTALPGRGYVLAKTAS
FT                   AAVVSLPSVVVVFVVAAAVKDVRLHAWQWLALTGVIWAGSLVFAALGVAIGYLATGDAV
FT                   RPITMIVYFGLSMLGGLWMPTTTFPQWLRDVAEWLPTHAYAALGQSIEQSHAPHAQDLA
FT                   VLAVYFVLFAGGAAWLYRKDTLKA"
     gtgaacggcc tgatcaagct cgaactgacc cgggcactgc gcaaccgaaa gttcctgttc        60
     ttctcggtga tctacccctc ggccctgttc ctgctcatcg cgggcagtgc cgacgccacc       120
     agcgaggtcg acggcaccgg actgaccctg cccaccttct tcatggtctc catggcctcc       180
     ttcggtgccc tgaccgccgt gctcatgggc aacagcgaac gcatcgccaa ggagcgcgag       240
     agcggctggg tccggcagct gcggctcacc gccctgcccg gccgcggcta cgtcctcgcc       300
     aagaccgcga gcgccgccgt cgtcagcctg ccttccgtcg tggtcgtctt cgtcgtcgcc       360
     gcggccgtga aggacgtacg ccttcacgcc tggcagtggc tcgccctcac cggcgtgatc       420
     tgggccggca gcctggtctt cgccgcgctc ggcgtcgcca tcgggtacct ggccaccggg       480
     gacgcggtcc gcccgatcac gatgatcgtg tacttcgggc tctccatgct cggcggcctg       540
     tggatgccca ccaccacctt cccgcagtgg ctgcgggacg tcgccgagtg gctgcccaca       600
     cacgcgtacg ctgccctcgg gcagtcgatc gaacagagtc acgccccgca cgcacaggac       660
     ctcgccgtcc tcgccgtcta cttcgtgctc ttcgcgggcg gcgcggcctg gctgtaccgg       720
     aaggacacgc tgaaggcgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page