(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5132

AL939122.SCO5132     Location/Qualifiers
FT   CDS_pept        210065..210679
FT                   /transl_table=11
FT                   /gene="SCO5132"
FT                   /gene_synonym="SC9E12.17"
FT                   /product="putative two-component system response regulator"
FT                   /note="SC9E12.17, possible two-component system response
FT                   regulator, len: 204 aa; similar to TR:CAB88186
FT                   (EMBL:AL352972) Streptomyces coelicolor  putative
FT                   two-component response regulator SCC30.16, 210 aa; fasta
FT                   scores: opt: 822 z-score: 928.1 E(): 0; 63.0% identity in
FT                   200 aa overlap. Contains Pfam matches to entries PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family.
FT                   Also contains possible helix-turn-helix motif at residues
FT                   159..180 (+5.28 SD)"
FT                   /db_xref="GOA:Q9F338"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F338"
FT                   /protein_id="CAC05762.1"
FT                   /translation="MSRTIKVLLAEDQAMVREALAALLGLEEDIEVVAQVARGDEVLDA
FT                   ARAHGVDVALLDIEMPGATGIEAAALVHRELPAVKLVVLTTFGRPGYLRSAMESGADAF
FT                   LVKDAPAAQLAEAVRRVLAGERVIDPTLAAAALAEGANPLTDREREILRAAADGSTNAE
FT                   LASALHLSQGTVRNYLSTAIQKLAVRNRAEAVRVARNKGWL"
     atgagccgca cgatcaaggt cctgctggcc gaggaccagg cgatggtccg cgaggcactg        60
     gccgccctgc tcggcctgga ggaggacatc gaggtcgtcg cccaggtggc gcgcggcgac       120
     gaggtgctgg acgccgcccg cgcccacggc gtggacgtgg ccctgctgga catagagatg       180
     cccggcgcga ccggcatcga ggcggccgcc ctggtccacc gggaactgcc ggccgtgaag       240
     ctggtcgtcc tcaccacctt cggccgcccc ggctacctgc gcagcgcgat ggagtccggc       300
     gccgacgcct tcctggtcaa ggacgccccg gccgcccagc tcgccgaagc ggtccgcagg       360
     gtgctggcgg gggagcgggt catcgacccg accctggcgg cagcggccct cgccgagggc       420
     gccaaccccc tcaccgaccg cgaacgcgag atcctccgcg ccgccgccga cggctccacc       480
     aacgccgaac tcgccagcgc cctccacctc tcccagggca cggtccgcaa ctacctgtcc       540
     acggccatcc agaaactggc cgtgagaaac cgcgcggagg cggtccgggt ggccaggaac       600
     aagggctggc tgtag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page