(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5134

AL939122.SCO5134     Location/Qualifiers
FT   CDS_pept        complement(211727..212761)
FT                   /transl_table=11
FT                   /gene="SCO5134"
FT                   /gene_synonym="SC9E12.19c"
FT                   /product="hypothetical protein"
FT                   /note="SC9E12.19c, hypothetical protein, len: 344 aa;
FT                   highly similar to TR:O87087 (EMBL:AB006206) Streptomyces
FT                   griseus AmfR, AmfA and AmfB genes and 4 ORFS, complete CDS,
FT                   ORF5, 264 aa; fasta scores: opt: 1018 z-score: 1086.7 E():
FT                   0; 63.3% identity in 264 aa overlap. Contains Pfam match to
FT                   entry PF00583 Acetyltransf, Acetyltransferase (GNAT)
FT                   family"
FT                   /db_xref="GOA:Q9F336"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F336"
FT                   /protein_id="CAC05764.1"
FT                   /translation="MEFSAAGRLEVRITTADVGKRVSVRRLSEAGAAGEKFTDTVGVLT
FT                   SWTDGVLLITRKSGESVRVAESALVAGKVVPPAPARRRGPAASYEELARVAARSWRPVE
FT                   SERLGAWELRAAGGFTRRANSVLPLGDPGLPLDEALTAVRRWYGVRGLPAYVQTATGAA
FT                   GTQELLCAELERRGWVREVTAEVWTGPLAPVADLAGDTGVVLSREADETWLARYQRKGV
FT                   SEVALRVLESGPSVWFATVPGAEGADGAGGGGGVAAIGRCVVDGRWASFAAVEVDPAQR
FT                   RRGLATAVMAALARRALDEGASAAWLQVETDNAGARALYAGMGFAAHHSYHHYREPAAA
FT                   GTDR"
     gtggaattct ctgccgccgg gcgtcttgag gtccgtatca ccactgctga cgtgggcaaa        60
     cgagtctccg tacggcgctt gagcgaagct ggtgccgcag gtgagaagtt caccgacacg       120
     gtcggcgttc tcacatcatg gaccgacggt gtgctgctga tcacacgaaa gagtggcgag       180
     tccgtccgtg tcgcggagtc cgccctggtc gccgggaagg tcgtgccgcc cgcccccgcc       240
     cgccgtcgcg gtcccgccgc gtcctacgag gagctggcgc gcgtcgccgc gcggtcctgg       300
     cgcccggtgg agagcgagcg gctcggcgcc tgggagctgc gggcggccgg gggcttcacc       360
     cggcgggcca actccgtgct gccgctcggc gatccggggc tgccgctcga cgaggcgctg       420
     acggccgtac gccgctggta cggcgtacgc gggctgcccg cgtacgtcca gaccgccacc       480
     ggcgccgccg gtacgcagga gctgctgtgc gcggagctgg agcggcgggg ctgggtccgg       540
     gaggtgacgg ccgaggtgtg gaccgggcca ctggcgccgg tcgccgacct ggccggggac       600
     accggtgtgg tcctgtcccg ggaggcggac gaaacctggc tcgcccggta ccagcgcaag       660
     ggggtgagcg aggtggcgct gcgagtcctg gagtccgggc cgtcggtgtg gttcgccacg       720
     gtgcccggcg cggagggcgc cgacggcgcg ggcggcgggg gcggcgtggc ggccatcgga       780
     cggtgtgtcg tggacgggcg gtgggcctcc ttcgcggccg tcgaggtcga tcccgcgcag       840
     cggcgccggg ggctcgcgac cgccgtgatg gccgcactgg cccggcgggc gctggacgag       900
     ggggcgtcgg cggcgtggct ccaggtggag accgacaacg ccggggcccg ggcgctgtac       960
     gccgggatgg gcttcgcggc gcaccactcc taccaccact accgggagcc cgcggccgcc      1020
     gggaccgacc ggtag                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page