(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5135

AL939122.SCO5135     Location/Qualifiers
FT   CDS_pept        212902..213222
FT                   /transl_table=11
FT                   /gene="SCO5135"
FT                   /gene_synonym="fdxA1"
FT                   /gene_synonym="SC9E12.20"
FT                   /product="ferredoxin"
FT                   /note="SC9E12.20, fdxA1, ferredoxin, len: 106 aa; similar
FT                   to SW:FER_SACER (EMBL:M61119) Saccharopolyspora erythraea
FT                   ferredoxin FdxA, 105 aa; fasta scores: opt: 618 z-score:
FT                   759.8 E(): 0; 78.1% identity in 105 aa overlap and to
FT                   TR:CAC04216 (EMBL:AL391515) Streptomyces coelicolor FdxA,
FT                   ferredoxin, 129 aa; fasta scores: opt: 520 z-score: 702.1
FT                   E(): 1.8e-33; 65.7% identity in 105 aa overlap. Contains
FT                   Pfam match to entry PF00037 fer4, 4Fe-4S binding domain and
FT                   match to Prosite entry PS00198 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature"
FT                   /db_xref="GOA:Q9F335"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F335"
FT                   /protein_id="CAC05765.1"
FT                   /translation="MTYVIAQPCVDVKDKACIEECPVDCIYEGQRSLYIHPDECVDCGA
FT                   CEPVCPVEAIFYEDDTPEEWKDYYKANVEFFDELGSPGGASKLGLIERDHPFVAALPPQ
FT                   NQ"
     gtgacctacg tcatcgcgca gccttgtgtc gacgtgaagg acaaggcgtg catcgaggag        60
     tgcccggtcg actgcatcta cgagggccag cggtccttgt acatccaccc ggacgaatgc       120
     gtcgactgtg gtgcctgtga gccggtctgc ccggtcgagg cgatcttcta cgaggacgac       180
     actcccgagg agtggaagga ctactacaag gcgaacgtcg agttcttcga cgagctcggc       240
     tcgcccggcg gcgccagcaa gctggggctg atcgagcgcg accacccctt cgtcgccgcg       300
     ctgccgccgc agaaccagta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page