(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5136

AL939122.SCO5136     Location/Qualifiers
FT   CDS_pept        213339..214436
FT                   /transl_table=11
FT                   /gene="SCO5136"
FT                   /gene_synonym="SC9E12.21"
FT                   /product="putative aminotransferase"
FT                   /note="SC9E12.21, probable aminotransferase, len: 365 aa;
FT                   similar to TR:O50434 (EMBL:AL010186) Mycobacterium
FT                   tuberculosis aminotransferase MTV005.14, 362 aa; fasta
FT                   scores: opt: 1448 z-score: 1704.1 E(): 0; 61.7% identity in
FT                   360 aa overlap. Contains match to Prosite entry PS00105
FT                   Aminotransferases class-I pyridoxal-phosphate attachment
FT                   site"
FT                   /db_xref="GOA:Q9F334"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F334"
FT                   /protein_id="CAC05766.1"
FT                   /translation="MSAVSDRLPTFPWDKLEPYKKTAAAHPGGIVDLSVGTPVDPVPEL
FT                   IQKALVDAADSPGYPTVWGTPALRDAITGWVERRLGARDVTHRHVLPVVGSKELVAWLP
FT                   TQLGLGPGDRVAFPRLAYPTYEVGARLARAEYEAYEDPTELDPAGLKLLWLNSPSNPTG
FT                   KVLSKADLTRIVAWAREHGVLVVSDECYLELGWEADPVSVLHPDVNGGSYDGLVAVHSL
FT                   SKRSNLAGYRAAFLAGDPAVLGPLLEIRKHGGMMTPAPTQAAVVAALGDDEHVRVQRER
FT                   YAARRTVLREALLGAGFRIEHSEASLYLWATRGESCWETVAHLAERGILVAPGDFYGPA
FT                   GAHFVRVALTATDDRVQAAADRLRS"
     gtgtccgcag tctccgaccg acttcccacc ttcccctggg acaagctgga gccgtacaag        60
     aagacggccg cagcgcaccc cggcggcatc gtcgacctct ccgtcggcac cccggtcgac       120
     ccggtccccg agctgatcca gaaggccctg gtcgacgcgg cggactcccc gggctacccg       180
     accgtctggg gcaccccggc gctgcgcgac gccatcaccg gctgggtgga gcgccgcctc       240
     ggcgcccgcg acgtcaccca ccgccacgtg ctgcccgtcg tcggctccaa ggaactcgtc       300
     gcctggctcc cgacccagct gggcctcggc cccggcgacc gggtggcctt cccgcgcctg       360
     gcctacccga cgtacgaggt cggcgcccgc ctggcccgtg cggagtacga ggcgtacgag       420
     gacccgaccg agctggaccc ggcgggactg aagctcctgt ggctcaactc cccgtcgaac       480
     ccgacgggca aggtcctgtc caaggccgac ctgacccgga tcgtcgcctg ggcccgcgag       540
     cacggcgtcc tcgtcgtctc cgacgagtgc tacctggagc tgggctggga ggccgacccg       600
     gtctcggtcc tgcacccgga cgtcaacggc ggctcctacg acggcctggt cgccgtccac       660
     tccctctcca agcgctccaa cctcgcgggc taccgcgcgg ccttcctggc cggtgacccg       720
     gcggtcctgg gcccgctcct ggagatccgc aagcacggcg gcatgatgac cccggcgccg       780
     acccaggccg ccgtggtggc ggccctcggc gacgacgagc acgtccgcgt ccagcgcgag       840
     cgctacgccg cccgccgcac ggtcctgcgc gaggccctgc tgggcgccgg cttccgcatc       900
     gagcacagcg aggccagcct ctacctctgg gccacccgcg gcgagtcgtg ctgggagacg       960
     gtcgcccacc tggccgaacg cggcatcctg gtggccccgg gcgacttcta cggcccggcg      1020
     ggcgcacact tcgtccgcgt agccctgacg gcaacggacg accgcgtcca ggcagcggcg      1080
     gaccgcctga ggtcctga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page