(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5139

AL939122.SCO5139     Location/Qualifiers
FT   CDS_pept        216476..217555
FT                   /transl_table=11
FT                   /gene="SCO5139"
FT                   /gene_synonym="dapE"
FT                   /gene_synonym="SCP8.02"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="SCP8.02, dapE, succinyl-diaminopimelate
FT                   desuccinylase, len: 359 aa; highly similar to SW:DAPE_CORGL
FT                   (EMBL:X81379) Corynebacterium glutamicum
FT                   succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) DapE,
FT                   369 aa; fasta scores: opt: 1189 z-score: 1383.5 E(): 0;
FT                   52.1% identity in 361 aa overlap. Contains Pfam match to
FT                   entry PF01546 Peptidase_M20, Peptidase family M20/M25/M40"
FT                   /db_xref="GOA:Q9FBL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL9"
FT                   /protein_id="CAC01340.1"
FT                   /translation="MADTPLDLTLDAAELTARLVDFPSESGTEKPLADAIESALRTLPH
FT                   LSVERYGNNLVARTGLGRAERVILAGHIDTVPIAGNVPSRLDEDGVLWGCGTCDMKAGV
FT                   AVQLRIAATVPAPNRDLTFVFYDNEEVAAELNGLKHVAEAHPEWLEGDFAVLLEPSDGQ
FT                   VEGGCQGTLRVLLKTAGERAHSARSWMGSNAIHAAAPILARLAAYEPRYPVIDGLEYRE
FT                   GLNAVGITGGVAGNVIPDECVVTVNFRYAPDRSPEEALAHVREVFDGCGVTDFVVDDHS
FT                   GAALPGLSHPAAAAFIEAVGGTPQPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDER
FT                   VEVAKILAGEERLRSWLTA"
     atggccgata ccccgcttga cctcacgctg gacgccgcgg agcttaccgc gcggctcgtc        60
     gacttcccgt ccgagagcgg caccgagaag cccctggcgg acgcgatcga gagcgccctg       120
     cggaccctgc cccacctgtc ggtcgagcgg tacggcaaca acctcgtcgc gcgcaccggc       180
     ctgggccgcg cggagcgcgt gatcctggcg ggccacatcg acaccgtgcc gatcgccggc       240
     aacgtcccgt cccggctgga cgaggacggc gtcctgtggg ggtgcggcac ctgcgacatg       300
     aaggcgggcg tcgcggtcca gctgcgcatc gcggccaccg tccccgcccc caaccgcgac       360
     ctgaccttcg tcttctacga caacgaggag gtcgccgccg agctgaacgg cctgaagcac       420
     gtcgccgagg cgcaccccga gtggctggag ggcgacttcg cggtgctcct cgaaccgtcc       480
     gacggccagg tggagggcgg ctgccagggc accctgcggg tgctgctgaa gaccgcgggg       540
     gagcgggcgc actcggcgcg ctcctggatg ggctccaacg ccatccacgc cgccgccccg       600
     atcctcgcgc gcctcgcggc gtacgagccc cgctacccgg tcatcgacgg cctggagtac       660
     cgcgagggcc tcaacgcggt cggcatcacg ggcggcgtgg ccggcaacgt catccccgac       720
     gagtgcgtgg tcaccgtcaa cttccgctac gccccggacc gcagtcccga ggaggccctg       780
     gcccacgtgc gcgaggtctt cgacggctgc ggggtgacgg acttcgtggt cgacgaccac       840
     agcggcgcgg ccctgcccgg cctgtcccac ccggccgcgg cggccttcat cgaggcggtg       900
     ggcggcaccc cgcagccgaa gtacggctgg acggacgtgt cccgcttctc ggcgctcggc       960
     gtcccggcgg tcaactacgg ccccggcaac ccgcacttgg cgcacaagcg cgacgagcgg      1020
     gtcgaggtgg cgaagatcct cgcgggggag gagcgcctgc gctcctggct gacggcatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page