(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5140

AL939122.SCO5140     Location/Qualifiers
FT   CDS_pept        217673..218431
FT                   /transl_table=11
FT                   /gene="SCO5140"
FT                   /gene_synonym="SCP8.03"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.03, hypothetical protein, len: 252 aa; similar
FT                   to TR:Q46063 (EMBL:X81379) Corynebacterium glutamicum ORF2,
FT                   211 aa; fasta scores: opt: 938 z-score: 1070.3 E(): 0;
FT                   67.1% identity in 210 aa overlap"
FT                   /db_xref="GOA:Q9FBL8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="PDB:5ZI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL8"
FT                   /protein_id="CAC01341.1"
FT                   /translation="MATGNPEGKKRPPEEQRLGPVLRRRGQVQESTTDQRLLDERAPTD
FT                   WVHTDPWRVLRIQSEFIEGFGTLAELPPAISVFGSARTPADSPEYDAGVRLGRGLVEAG
FT                   FAVITGGGPGAMEAANKGALEAKGTSVGLGIELPFEQGLNPYVDIGLNFRYFFVRKMMF
FT                   VKYAQGFVVLPGGLGTLDELFEALTLVQTQKVTRFPIVLFGSEYWGGLVDWLRGTLVAQ
FT                   GKAAEKDLMLFHVTDDVDEAVALVSKEAGR"
     atggctaccg gcaaccccga gggcaagaag cggccaccgg aggagcagcg cctgggcccc        60
     gtcctccggc ggcggggcca ggtgcaggag agcaccacgg accagcgcct gctggacgag       120
     cgtgctccga cggactgggt ccacaccgac ccctggcggg tgctgcgcat ccagtcggag       180
     ttcatcgagg gcttcggcac gctggccgaa ctgccacccg ccatcagcgt cttcggctcc       240
     gcccgcacgc cggcggactc accggagtac gacgccggcg tacggctggg ccgcgggctg       300
     gtggaggcgg gcttcgccgt catcaccggc ggcgggcccg gcgccatgga ggcggccaac       360
     aagggcgccc tggaggcgaa gggcacgtcg gtcggcctgg gcatcgagct gcccttcgaa       420
     caggggctca acccctacgt cgacatcggc ctgaacttcc gctacttctt cgtccgcaag       480
     atgatgttcg tgaagtacgc gcagggcttc gtcgtgctgc ccggcggcct cggcaccctg       540
     gacgaactct tcgaggccct caccctggtg cagacccaga aggtgacccg cttccccatc       600
     gtcctgttcg gctcggagta ctggggcggc ctggtggact ggctccgcgg caccctggtg       660
     gcccagggca aggccgcgga gaaggacctc atgctcttcc acgtcaccga cgacgtggac       720
     gaggcggtcg ccctggtctc caaggaggcg ggccggtaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page