(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5141

AL939122.SCO5141     Location/Qualifiers
FT   CDS_pept        complement(218682..219566)
FT                   /transl_table=11
FT                   /gene="SCO5141"
FT                   /gene_synonym="folP"
FT                   /gene_synonym="SCP8.04c"
FT                   /product="dihydropteroate synthase"
FT                   /note="SCP8.04c, folP, dihydropteroate synthase, len: 294
FT                   aa; similar to SW:DHPS_MYCLE (EMBL:U15180) Mycobacterium
FT                   leprae dihydropteroate synthase (EC 2.5.1.15) (DHPS) FolP,
FT                   291 aa; fasta scores: opt: 1095 z-score: 1239.8 E(): 0;
FT                   60.6% identity in 292 aa overlap. Contains Pfam match to
FT                   entry PF00809 DHPS, Dihydropteroate synthase and matches to
FT                   Prosite entries PS00792 Dihydropteroate synthase signature
FT                   1 and PS00793 Dihydropteroate synthase signature 2"
FT                   /db_xref="GOA:Q9FBL7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL7"
FT                   /protein_id="CAC01342.1"
FT                   /translation="MDQEMSQGMLRLGRREFAAHEPVIMAIVNRTPDSFYDRGATFGDE
FT                   PALARVEQAVAEGAAIIDVGGVKAGPGDEVSAAEEARRTVGFVAEVRRRHPDVVISVDT
FT                   WRHEVGEAVCEAGADLLNDAWGGVDPKLAEVAARYGVGLVCTHAGGAEPRTRPHRVTYD
FT                   DVVADVLRVTLGLAERAVGLGVPRESVLIDPGHDFGKNTRHSLEATRRLGEMVETGWPV
FT                   LVSLSNKDFVGETLDRPVKERLIGTLATTAVSAWLGARVYRVHEVAETRQVLDMVATIA
FT                   GHREPAVARRGLA"
     gtggaccagg agatgtcaca ggggatgctc aggctgggca ggcgcgaatt cgcggcgcac        60
     gagccggtga tcatggccat cgtgaaccgt accccggact ccttctacga ccggggagcg       120
     accttcggcg acgagcccgc cctcgcccgc gtggagcagg cggtggccga gggcgccgcg       180
     atcatcgacg tcggcggggt gaaggccggt cccggggacg aggtgtcggc cgcggaggag       240
     gcgcggcgga cggtggggtt cgtcgcggag gtgcgacgtc ggcacccgga cgtcgtgatc       300
     agcgtggaca cctggcggca cgaggtcggc gaggccgtct gcgaggccgg ggcggacctg       360
     ctgaacgacg cgtggggcgg cgtcgacccg aagctcgcgg aggtcgcggc ccggtacggg       420
     gtggggctgg tgtgcacgca cgcgggcggc gccgagccac ggacgcggcc gcaccgggtg       480
     acgtacgacg acgtcgtggc cgacgtcctg cgggtgacgc tggggctggc cgagcgggcg       540
     gtggggctgg gggtgccgcg ggagtcggtg ctgatcgacc ccgggcacga cttcgggaag       600
     aacacccggc acagcctgga ggcgacgcga cggctcgggg agatggtgga gacggggtgg       660
     ccggtgctgg tgtccctgtc gaacaaggac ttcgtcgggg agacgctgga ccggccggtg       720
     aaggaacggc tgatcggcac gctggcgacc acggcggtgt cggcgtggct gggcgccagg       780
     gtgtaccggg tgcacgaggt ggcggagacc cggcaggtgc tggacatggt ggcgacgatc       840
     gccgggcacc gggagccggc ggtggcgcgg cgggggctgg cctag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page