(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5144

AL939122.SCO5144     Location/Qualifiers
FT   CDS_pept        complement(221303..222106)
FT                   /transl_table=11
FT                   /gene="SCO5144"
FT                   /gene_synonym="SCP8.07c"
FT                   /product=" putative acyl CoA isomerase"
FT                   /note="SCP8.07c, probable acyl CoA isomerase, len: 267 aa;
FT                   highly similar to TR:AAF73478 (EMBL:AF268489) Streptomyces
FT                   collinus 2-cyclohexenylcarbonyl CoA isomerase ChcB, 269 aa;
FT                   fasta scores: opt: 1476 z-score: 1623.5 E(): 0; 87.6%
FT                   identity in 266 aa overlap and to SW:CRT_CLOAB
FT                   (EMBL:U17110) Clostridium acetobutylicum
FT                   3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55) Crt, 261 aa;
FT                   fasta scores: opt: 426 z-score: 476.6 E(): 4.4e-19; 32.4%
FT                   identity in 259 aa overlap. Contains Pfam match to entry
FT                   PF00378 ECH, Enoyl-CoA hydratase/isomerase family and match
FT                   to Prosite entry PS00166 Enoyl-CoA hydratase/isomerase
FT                   signature"
FT                   /db_xref="GOA:Q9FBL4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL4"
FT                   /protein_id="CAC01345.1"
FT                   /translation="MADTVLYEVSDGLATITLNRPEAMNALNIETKVALRDAVRSAAAD
FT                   DAVRAVLLTAAGDRAFCVGQDLKEHIGLLAADRETGSGQTMSTVREHYNPIVRALAGAE
FT                   KPVVAAVNGVAAGAGLGFALAADYRIVADTAAFNTSFAGVALTADSGISWTLPRVVGPG
FT                   RAADLLLFPRSIRAQEAYELGIATRVVPAADLRAEAEKTARALAEGPTVAYAALKEAMA
FT                   YGLTHSLSETLDKEDELQSRAGASEDHAIAVRAFVEKGKPKYLGR"
     atggccgaca ccgtgctcta cgaagtgagc gacgggctcg cgacgatcac gctgaaccgc        60
     cccgaggcga tgaacgcgct gaacatcgag accaaggtcg cgctccggga cgcggtgcgc       120
     tccgcggcgg cggacgacgc cgtacgggcg gtgctgctga ccgcggccgg ggaccgggcg       180
     ttctgtgtcg gccaggacct caaggagcac atcgggctgc tggccgccga ccgggagacg       240
     ggctcggggc agacgatgag cacggtgcgc gagcactaca acccgatcgt ccgggcgctg       300
     gccggcgcgg agaagccggt ggtcgccgcc gtgaacggcg tggcggccgg cgcggggctc       360
     ggtttcgcgc tcgccgcgga ctaccggatc gtcgcggaca cggcggcgtt caacacgtcc       420
     ttcgcgggcg tggcgctcac cgcggactcc ggcatctcct ggacgctgcc gcgcgtcgtc       480
     ggccccggcc gcgccgccga cctgctgctc ttcccgcgca gcatccgcgc gcaggaggcg       540
     tacgagctgg gcatcgccac ccgtgtcgtc cccgccgccg acctgcgcgc cgaggccgag       600
     aagacggcgc gggcgctggc cgaggggccg acggtggcgt acgcggcgct gaaggaggcg       660
     atggcgtacg ggctgacgca ctcgctgtcc gagacgctgg acaaggagga cgagcttcag       720
     tcccgggcgg gcgcctccga ggaccacgcg atcgcggtgc gcgcgttcgt cgagaagggg       780
     aagccgaagt atctgggccg gtag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page