(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5147

AL939122.SCO5147     Location/Qualifiers
FT   CDS_pept        223690..224361
FT                   /transl_table=11
FT                   /gene="SCO5147"
FT                   /gene_synonym="SCP8.10"
FT                   /product="putative ECF-subfamily sigma factor"
FT                   /note="SCP8.10, probable ECF-subfamily sigma factor, len:
FT                   223 aa; similar to TR:O05735 (EMBL:U87308) Mycobacterium
FT                   avium extracytoplasmic function alternative sigma factor
FT                   SigE, 251 aa; fasta scores: opt: 852 z-score: 1013.1 E():
FT                   0; 62.5% identity in 216 aa overlap and to SW:CARQ_MYXXA
FT                   (EMBL:X71062) Myxococcus xanthus RNA polymerase sigma
FT                   factor CarQ, 174 aa; fasta scores: opt: 285 z-score: 347.6
FT                   E(): 6.8e-12; 36.5% identity in 159 aa overlap. Contains
FT                   Pfam match to entry PF00776 Sigma70_ECF, Sigma-70 factor
FT                   (ECF subfamily). Also contains a possible helix-turn-helix
FT                   motif at residues 164..185 (+3.76 SD)"
FT                   /db_xref="GOA:Q9FBL1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL1"
FT                   /protein_id="CAC01348.1"
FT                   /translation="MNDTAADHSHADGPTTGHAHTATFSSDADGQAWTPPTWEEIVSTH
FT                   SGRVYRLAYRLTGNQHDAEDLTQEVFVRVFRSLSTYTPGTFEGWLHRITTNLFLDMVRR
FT                   KQRIRFDALGDDAAERLPSREPTPQQLFHDAHFDADVQQALDTLAPEFRAAVVLCDIEG
FT                   LSYEEIAATLGVKLGTVRSRIHRGRSQLRKALAHRSPKARADRRSLAAGVPALGGGGTS
FT                   A"
     gtgaacgaca ccgctgctga ccacagccac gccgacggtc ccaccacggg acacgcccat        60
     accgcgacct tctccagcga cgcggacggg caggcgtgga ctccgcccac ctgggaggag       120
     atcgtcagca cccacagcgg ccgggtctac cgcctcgcct accgcctcac gggcaaccag       180
     cacgacgccg aggacctcac ccaagaggtc ttcgtccgtg tcttccgctc cctgtcgacc       240
     tacacgccgg gcaccttcga gggctggctg caccgcatca cgaccaatct cttcctcgac       300
     atggtgcgcc gcaagcagcg catccggttc gacgcgctgg gcgacgacgc ggccgagcgg       360
     ctgcccagca gggagcccac cccgcagcag ctcttccacg acgcccactt cgacgcggac       420
     gtccagcagg cgctggacac cctcgcgccc gagttccgcg ccgccgtcgt cctgtgcgac       480
     atcgaggggc tgtcgtacga ggagatcgcc gcgaccctgg gcgtcaagct gggcacggtg       540
     cgctcccgca tccaccgcgg ccgttcccag ctgcgcaagg cgctcgcgca ccggtccccg       600
     aaggcgcgtg ccgaccgtcg ctcgctggcg gccggtgtgc ccgcactggg aggagggggc       660
     acgagcgcgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page