(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5148

AL939122.SCO5148     Location/Qualifiers
FT   CDS_pept        224358..225347
FT                   /transl_table=11
FT                   /gene="SCO5148"
FT                   /gene_synonym="SCP8.11"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.11, possible membrane protein, len: 329 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL0"
FT                   /protein_id="CAC01349.1"
FT                   /translation="MSGSRPEPEGHLAEQHLGDRLSALVDGELGHDARERVLAHVATCP
FT                   KCKAEVDAQRRLKNVFAEAAPPAPSESFLARLQGLPGGGDSDGGGSPFSGLPGGFGASA
FT                   ASGVFGPRRDERFEFDYVPAGSHTPVLPSATSGRGFRIHEVGRHESDRSASRGLRFAFA
FT                   AAGAVSLAAIALGGVTLGTPDTTTEARGSGSGSNVTPLRTPGSAAATGSESQRRRTAGP
FT                   LLGQGQRALGDLPVASTTASAPLLPGMPAPAGGDARQQAVRALTTPVTAGAAAMSPLIR
FT                   PLEAVPPLSLSSWSAAPEVRPPGLLAAPDPAPSPYPAASPAASSSPLR"
     gtgagtgggt cacggcctga gcccgaggga cacctcgcag agcagcacct gggagaccga        60
     ctctccgccc tggtggacgg agagctcggt catgacgcgc gcgagcgcgt gctggcgcac       120
     gtggcgacct gcccgaagtg caaggcggag gtcgacgcgc agcgccggtt gaagaacgtc       180
     ttcgcggaag cggccccgcc ggccccgtcc gagagcttcc tggcccgcct ccaggggctt       240
     cccggcggcg gtgactccga cggcggcggc tcgccgttca gcgggctgcc cggaggcttc       300
     ggcgcgtccg cggcatccgg tgtcttcggc ccgaggcggg acgagcggtt cgagttcgac       360
     tacgtccccg ccgggtcgca caccccggtg ctgccgtccg ccacgtcggg gcgcggcttc       420
     cgcatccacg aggtgggcag gcatgagtcc gaccgttcgg cctcccgcgg tctgcggttc       480
     gccttcgccg ccgccggagc ggtgtcgctg gccgcgatcg cgctgggcgg cgtcaccctc       540
     ggcacaccgg acaccaccac cgaggcacgc ggctcgggca gcggcagcaa tgtgacgccg       600
     ctgcgcaccc cgggctcggc cgcggccacc ggttccgaga gccagcgccg ccgcacggcc       660
     gggccactgc tcgggcaggg gcagcgcgcg ctcggtgacc tccccgtcgc gtccaccacg       720
     gcctcggcgc cactgctgcc cgggatgccg gcccccgccg ggggcgacgc acggcagcag       780
     gccgtccggg cgctgaccac cccggtgacg gccggtgccg ccgccatgtc cccgctgata       840
     cgtccgctgg aagccgttcc gccgctctcc ctgagctcct ggtcggcggc gccagaggtc       900
     aggccgcccg gcctgctcgc cgcccccgac cccgctccgt ccccctaccc ggcggcttcc       960
     ccggccgcct cctcctctcc gcttcgctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page