(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5149

AL939122.SCO5149     Location/Qualifiers
FT   CDS_pept        225838..227466
FT                   /transl_table=11
FT                   /gene="SCO5149"
FT                   /gene_synonym="SCP8.12"
FT                   /product="putative protease"
FT                   /note="SCP8.12, possible protease, len: 542 aa; C-terminal
FT                   region similar to TR:O53896 (EMBL:AL021999) Mycobacterium
FT                   tuberculosis putative serine protease MTV044.11, 464 aa;
FT                   fasta scores: opt: 803 z-score: 614.5 E(): 9.2e-27; 39.4%
FT                   identity in 469 aa overlap and to TR:AAF61294
FT                   (EMBL:AF155705) Lactococcus lactis serine protease HtrA,
FT                   408 aa; fasta scores: opt: 536 z-score: 415.8 E(): 1.1e-15;
FT                   34.8% identity in 310 aa overlap. Contains Pfam matches to
FT                   entries PF00089 trypsin, Trypsin and PF00595 PDZ, PDZ
FT                   domain (Also known as DHR or GLGF)"
FT                   /db_xref="GOA:Q9FBK9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK9"
FT                   /protein_id="CAC01350.1"
FT                   /translation="MEAGSRPHAGTGSVPAADGTSDAGRPKPLHEPDPYSTPPYGEPGP
FT                   WAPAPPVQHPAATPAHGTVTAAGGALHAPVTPVTEGSHAHVPHPGASSVSPPVGAVPDP
FT                   AFADAAPPVPPTAQEQPPAPAATPAYDTAPHDAAPPPAAPADPWGRYDPWAASAQHHDA
FT                   AERAPKRRRGPRAKALVGGALLIALVSGGIGGGVGAYLERNGGVGTVELPQAGPEAAER
FT                   DPDSVAGIAARALPSVVTLHVSGSEAAGTGTGFVLDGRGHILTNNHVVEPAGSGGEITV
FT                   TFNSGDTAEAEVVGRDSGYDLAVVKVKGVTGLTPMPLGNSDNVRVGDPVVAIGAPFDLA
FT                   GTVTSGIISAKERPITAGGEEGDGSDISYVDALQTDAPINPGNSGGPLLDARGRAIGIN
FT                   SAIRSADSGSTESDDGQAGSIGLGFAIPINQGKRVAEELINTGKAAHPVIGITLDMNYT
FT                   GDGARVSAKGGDGGPAVTTGGPGAKAGIKPGDVITAVDGQRVHSGEELIVKTRAHRPGD
FT                   RLELTLQRDGKETKVSLVLGSSGDD"
     gtggaggcgg ggtcgcggcc ccacgcgggg accggctccg ttccggccgc cgacggcacg        60
     tccgacgccg ggcggcccaa gccgctgcac gaacccgacc cgtacagcac cccgccgtac       120
     ggtgagcccg gcccctgggc ccccgcaccg ccggtccagc accccgcggc caccccggcg       180
     cacggcacgg tgacggccgc gggaggggcg ctgcacgccc cggtcacgcc cgtgacggag       240
     ggctcgcacg cccacgtgcc gcacccgggc gcgtcgtcgg tgtctccgcc cgtgggtgcg       300
     gtgcccgacc ccgccttcgc ggacgccgcg cccccggtgc cgccgacggc gcaggagcag       360
     cctccggcgc cggccgccac cccggcgtac gacacggcgc cccacgacgc ggccccaccc       420
     ccggccgcgc ccgccgaccc gtgggggcgc tacgacccct gggccgcctc cgcgcagcac       480
     cacgacgctg ccgagcgcgc gccgaagcgg cgacgcgggc cgcgcgcgaa ggcgctcgtc       540
     ggcggggcgc tgctcatcgc cctggtctcc ggcggcatcg gcggcggcgt gggcgcgtac       600
     ctggaacgga acggcggcgt gggcactgtg gagctgcccc aggccggacc cgaggcggcc       660
     gagcgggacc cggacagcgt cgcgggcatc gccgcgcgtg ccctacccag cgtggtgacc       720
     ctgcacgtga gcggcagcga ggcggccggc accggcaccg ggttcgtgct cgacggccgc       780
     ggccacatcc tgaccaacaa ccacgtcgtg gagcccgccg gctccggcgg cgagatcacc       840
     gtgaccttca acagcggcga caccgccgag gccgaggtcg tcggccggga cagcgggtac       900
     gacctcgccg tggtgaaggt caagggcgtc accggcctca cccccatgcc cctcggcaac       960
     tccgacaacg tgcgcgtcgg cgaccccgtc gtcgccatcg gcgccccctt cgacctggcc      1020
     ggcaccgtca cctccggcat catcagcgcc aaggaacggc ccatcaccgc gggcggcgag      1080
     gagggcgacg gcagcgacat ctcgtacgtc gacgccctgc agaccgacgc gcccatcaac      1140
     cccggcaact ccggcggccc cctcctggac gcgcggggcc gggccatcgg catcaactcc      1200
     gccatccgct ccgccgacag cggcagcacc gagtcggacg acgggcaggc cggttccata      1260
     ggcctcggct tcgcgatccc catcaaccag ggcaagcgcg tcgccgagga actgatcaac      1320
     accggcaagg ccgcccaccc cgtcatcggc atcaccctcg acatgaacta cacgggtgac      1380
     ggcgcccgcg tgagtgccaa gggcggcgac ggcggacccg cggtcaccac cggcggcccc      1440
     ggcgcgaagg ccggcatcaa gcccggggac gtgatcaccg cggtcgacgg acaacgcgtg      1500
     cactccggcg aggaactcat cgtcaagacc cgcgcccacc gacccggcga ccgcctggaa      1560
     ctgaccctgc aacgcgacgg caaggagacg aaggtctcac tggtgctcgg ctcctccggc      1620
     gacgactga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page