(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5150

AL939122.SCO5150     Location/Qualifiers
FT   CDS_pept        227613..228098
FT                   /transl_table=11
FT                   /gene="SCO5150"
FT                   /gene_synonym="SCP8.13"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.13, putative membrane protein, len: 151 aa;
FT                   similar to TR:O69415 (EMBL:AJ005830) Escherichia coli
FT                   Sec-independent protein translocase TatB, 171 aa; fasta
FT                   scores: opt: 169 z-score: 186.8 E(): 0.0061; 23.6% identity
FT                   in 161 aa overlap. High in aspartate, glutamate and serine
FT                   amino acid residues. Highly similar to TR:Q9EWB3
FT                   (EMBL:AJ292256) Streptomyces lividans twin arginine
FT                   translocation complex component TatB 158 aa; fasta scores:
FT                   opt: 1001  Z-score: 1020.1 E(): 3.5e-49; 97.516% identity
FT                   in 161 aa overlap. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9FBK8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FBK8"
FT                   /protein_id="CAC01351.1"
FT                   /translation="MFNDIGALELVTLVVLAVLVFGPDKLPKVIQDVTRTIRKIREFSD
FT                   SAKQDIRQELGPEFKDFEFEDLNPKTFIRKQLDNEELGLKEIRNGFDLKKEMAEVTDAV
FT                   HGRDAESSSSGSSSGSSSAASGNGRVDMSKKPEKPEKPGKTDKPAADDRPPFDMDAT"
     gtgttcaatg acataggcgc actagagctg gtgacgctcg tcgtcctcgc cgtgctcgtc        60
     ttcggtccgg acaagctccc caaggtcatc caggacgtga cgcgcaccat ccggaagatc       120
     cgggagttct cggacagcgc caagcaggac atccgccagg agctgggccc cgagttcaag       180
     gacttcgagt tcgaggacct caaccccaag accttcatcc gcaagcagct ggacaacgaa       240
     gagctggggc tcaaggagat ccgcaacggc ttcgacctga agaaggagat ggccgaggtc       300
     accgacgcgg tccacggccg cgacgcggag tcctcgtcct cggggtcgtc ctccggatcg       360
     tcgtccgccg cgtccggcaa cggccgcgtc gacatgtcga agaagcccga gaagcccgag       420
     aagcccggga agaccgacaa gcccgccgcc gacgaccgcc cgcccttcga catggacgcc       480
     acctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page