(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5151

AL939122.SCO5151     Location/Qualifiers
FT   CDS_pept        228255..229001
FT                   /transl_table=11
FT                   /gene="SCO5151"
FT                   /gene_synonym="SCP8.14"
FT                   /product="hypothetical protein SCP8.14"
FT                   /note="SCP8.14, unknown, len: 248 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK7"
FT                   /protein_id="CAC01352.1"
FT                   /translation="MRTGRVRPKGGGPFRSDESEEASGHMETTSRAVAQAPAAEGGPQS
FT                   PSGRRTVDGYLRAPFPWYGLDEAFTGRRWLMQIGTAADGAVEHGSIGHGDEPSVRNEHV
FT                   AGDEQDAKEKFAVVVTVAANPDRRSADGTGLLEATSVSSAAWLAGVGLLSFTWPGQMDH
FT                   SLRDDWLEQQTETAWVLADDLDGEDWTTLSLPVDGVPTPFHYRESEFGWVLAGSTEQGV
FT                   HLGAYGRGMSAYGLAFAVVKDVAAYA"
     gtgcggaccg gacgagtgcg cccgaagggg ggcgggccgt tccggtccga cgagagcgag        60
     gaggcgtccg ggcacatgga gacgacgagt cgggcagtcg cgcaggcgcc ggccgcggag       120
     ggcggaccac agtccccctc cggccggcgt acggtcgacg gctacctgcg tgcgcccttc       180
     ccgtggtacg gcctcgacga ggccttcacg gggcggcgct ggctgatgca gatcggtacg       240
     gcggccgacg gggccgtgga gcacggctcg atcgggcacg gcgacgaacc gtcggtgcgc       300
     aacgagcacg tggcgggcga cgagcaggac gccaaggaga agttcgcggt cgtggtgacc       360
     gtcgcggcca accccgaccg gcgcagcgcc gacggcaccg gcctgctgga ggccacctcg       420
     gtgtcctcgg cggcctggct ggccggcgtg gggctgctgt cgttcacctg gcccggccag       480
     atggaccact cgctgcgcga cgactggctg gagcagcaga cggagaccgc ctgggtcctc       540
     gcggacgacc tcgacggcga ggactggacg acgctgtccc tgccggtgga cggcgtgccg       600
     acgcccttcc actaccggga gtccgagttc ggctgggtgc tggccggttc gaccgagcag       660
     ggcgtgcacc tcggcgcgta cgggcggggc atgagcgcgt acgggctggc cttcgccgtc       720
     gtcaaggacg tcgccgcgta cgcctag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page