(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5154

AL939122.SCO5154     Location/Qualifiers
FT   CDS_pept        complement(230843..232144)
FT                   /transl_table=11
FT                   /gene="SCO5154"
FT                   /gene_synonym="SCP8.17c"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.17c, hypothetical protein, len: 433 aa; highly
FT                   similar to TR:O86315 (EMBL:Z98260) Mycobacterium
FT                   tuberculosis hypothetical 47.4 kD protein MTV006.04c, 435
FT                   aa; fasta scores: opt: 1335 z-score: 1494.5 E(): 0; 49.9%
FT                   identity in 425 aa overlap and C-terminal region similar to
FT                   C-terminal region of TR:Q9X0P4 (EMBL:AE001773) Thermotoga
FT                   maritima Mg2+ transporter MgtE, putative, 446 aa; fasta
FT                   scores: opt: 390 z-score: 439.1 E(): 5.4e-17; 31.3%
FT                   identity in 240 aa overlap"
FT                   /db_xref="GOA:Q9FBK4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK4"
FT                   /protein_id="CAC01355.1"
FT                   /translation="MAAGAPRIFVSHLSGIAVFDPAGDQVGRVRDLVVMLRVGRKPPRV
FT                   LGLVVELTTRRRIFLPMTRVTGIESGQVITTGVLNVRRFEQRPTERLVFGELLDRRVTL
FT                   TETGEEVTVLDLSVQQLPARRDWEIDKVFVRKGRKGGAFRRNKGETLTVEWSGVSGFSV
FT                   EEQGQGAENLLATFEQLRPADLANVLHHLSAKRRAEVAAALDDDRLADVLEELPEDDQI
FT                   EILGKLKEERAADVLEAMDPDDAADLLGELPEADKERLLSLMQPEDAADMRRLMAYEEH
FT                   TAGGLMTTEPIVLRPDATVADALARIRNPDLSPAHAAQVYVCRPPEETPTGKYLGTVHF
FT                   QRLLRDPPYTLVGSILDDDLQPLEPDAALPVVAGFFAAYDMVAAPVVDDSGALLGAVTV
FT                   DDVLDHMLPDDWRETEYHLDETTGTTGEVGADGA"
     atggcagcgg gcgccccccg gatcttcgtc tcccacctct ccggcatcgc cgtcttcgac        60
     ccggccggtg accaggtggg gcgcgtccgc gatctggtcg tcatgctccg cgtcggccgc       120
     aaacccccgc gcgtcctcgg actggtcgtc gaactcacca cccgccgccg gatcttcctg       180
     cccatgaccc gggtcaccgg catcgagtcc ggccaggtga tcaccaccgg cgtgctcaac       240
     gtgcggcgtt tcgagcagcg gcccaccgag cgcctcgtct tcggcgagct gctcgaccgg       300
     cgggtcacgc tcaccgagac gggcgaggag gtcaccgtgc tcgacctgtc ggtgcagcag       360
     ttgcccgccc gacgggactg ggagatcgac aaggtcttcg tccgcaaggg caggaagggc       420
     ggcgccttcc gccgcaacaa gggcgagacc ctgaccgtgg agtggtccgg cgtctccggc       480
     ttctccgtcg aggagcaggg gcagggcgcc gagaacctgc tggccacctt cgagcagctg       540
     cgccccgccg acctcgccaa cgtcctgcac cacctgtccg ccaagcgccg cgccgaggtc       600
     gccgccgccc tcgacgacga ccggctggcc gacgtgctgg aggagctgcc ggaggacgac       660
     cagatcgaga tcctcggcaa gctcaaggag gagcgcgccg cggacgtcct ggaggcgatg       720
     gaccccgacg acgcggccga cctgctcggg gagctgcccg aggcggacaa ggagcggctg       780
     ctgagtctga tgcagcccga ggacgcggcc gacatgcggc gcctgatggc gtacgaggag       840
     cacacggccg gcggtctgat gacgaccgag ccgatcgtgc tgcgccccga cgcgaccgtc       900
     gccgacgccc tggcccgcat ccgcaacccc gacctgtccc cggcgcacgc cgcccaggtc       960
     tacgtctgcc gcccgcccga ggagaccccg accggcaagt acctgggcac cgtccacttc      1020
     cagcgcctgc tgcgcgaccc cccgtacacg ctggtcggct cgatcctcga cgacgacctg      1080
     caacccctgg agccggacgc ggcgctgccg gtggtcgccg ggttcttcgc cgcgtacgac      1140
     atggtcgcgg cgcccgtcgt ggacgactcg ggggcgctgc tcggcgcggt caccgtggac      1200
     gacgtgctgg accacatgct gcccgacgac tggcgggaga ccgagtacca cctcgacgag      1260
     acgacgggga cgacggggga ggtgggcgcc gatggtgcct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page