(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5156

AL939122.SCO5156     Location/Qualifiers
FT   CDS_pept        complement(233185..233697)
FT                   /transl_table=11
FT                   /gene="SCO5156"
FT                   /gene_synonym="SCP8.19c"
FT                   /product="hypothetical protein SCP8.19c"
FT                   /note="SCP8.19c, unknown, len: 170 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK2"
FT                   /protein_id="CAC01357.1"
FT                   /translation="MTSELLDQALVEEATKKSGLVWVKGPGVPARALWHVWHDGAACVV
FT                   GDGPGEQPLPGLADGAAAEVTVRSKDKGGRLVSWAARVVELPSGSEAWQAAVGDLKGKR
FT                   LNAPDGEAMTGRWARECRVLRLEPTGTTAPLPDASLAEAPLPSPATTRQPVPAGLPRLL
FT                   LKRRKRR"
     atgacaagcg agctgctcga ccaggccctc gtcgaggagg ccaccaagaa gtccggcctc        60
     gtctgggtca agggccccgg ggtgcccgcc cgggcgctgt ggcacgtctg gcacgacggc       120
     gcggcctgcg tcgtcggcga cggaccgggc gagcagccgc tgccgggtct tgccgacggg       180
     gccgcggccg aggtgacggt gcgcagcaag gacaagggcg gccggctggt ctcctgggcc       240
     gcccgggtcg tggagctgcc gtccggctcc gaggcgtggc aggcggcggt gggcgacctg       300
     aagggcaaac ggctcaacgc cccggacggc gaggccatga ccggccgctg ggcccgcgag       360
     tgccgggtgc tgcgcctgga gccgacgggg accacggcgc cgctgcccga cgcctcgctg       420
     gccgaggcac cgctgccgag cccggcgacg acccggcagc cggtgccggc cggactgccg       480
     cgcctgctgc tgaagcgccg caaacggcgc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page