(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5157

AL939122.SCO5157     Location/Qualifiers
FT   CDS_pept        complement(233731..234846)
FT                   /transl_table=11
FT                   /gene="SCO5157"
FT                   /gene_synonym="SCP8.20c"
FT                   /product="putative metal-transport protein"
FT                   /note="SCP8.20c, probable metal-transport protein, len: 371
FT                   aa; similar to TR:O50455 (EMBL:AL021006) Mycobacterium
FT                   tuberculosis putative magnesium and cobalt transport
FT                   protein MTV006.11c, 366 aa; fasta scores: opt: 1137
FT                   z-score: 1293.8 E(): 0; 47.8% identity in 370 aa overlap
FT                   and to SW:CORA_ECOLI (EMBL:L11042) Escherichia coli
FT                   magnesium and cobalt transport protein CorA, 316 aa; fasta
FT                   scores: opt: 211 z-score: 245.7 E(): 3.2e-06; 23.2%
FT                   identity in 306 aa overlap. Contains Pfam match to entry
FT                   PF01544 CorA, CorA-like Mg2+ transporter protein and
FT                   possible hydrophobic membrane spanning region at C-terminal
FT                   domain"
FT                   /db_xref="GOA:Q9FBK1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK1"
FT                   /protein_id="CAC01358.1"
FT                   /translation="MSMIRDLRAAVRPSRVSLRKDGGAYDTTRDPATASAVVDCAVYHD
FT                   GTRVETDVPLTPHTAMRQVRRDGGFVWIGLHEPTEDEFAGIAREFGLHPLAVEDAVQAH
FT                   QRPKLERYDDSLFTVFKTVHYVDHDQLTANSEVVETGEVMCFTGRDFFITVRHGGQGSL
FT                   RALRRRLQEDPELLLKGPSAVLHAIADHVVDGYIAVADAVQDDIDEVETEVFSPGRKGS
FT                   PRGTDAGRIYQLKREVLEFKRAVAPLLRPMQLLSERPMRLVDPEIQKYFRDVADHVARV
FT                   QEQVIGFDELLNSILQANLAQASVAQNEDMRKITSWAAIIAVPTMVCGVYGMNFDYMPE
FT                   THWKFGYPLVLSVTVCICLGIHRTLKRNGWL"
     atgtcgatga tccgtgacct gcgcgccgcg gtccgcccgt cccgcgtctc gctgcgcaag        60
     gacggcggtg cctacgacac cacccgtgac ccggcgacgg cctccgccgt cgtcgactgc       120
     gccgtctacc acgacggcac ccgcgtcgag acggacgtgc cgctgacccc gcacacggcg       180
     atgcgccagg tgcgtcgcga cggcgggttc gtgtggatcg gcctgcacga gcccaccgag       240
     gacgagttcg ccggtatcgc ccgggagttc gggctgcacc cgctggccgt ggaggacgcc       300
     gtccaggccc accagcggcc caagctggag cgctacgacg actccctgtt cacggtcttc       360
     aagaccgtcc actacgtcga ccacgaccag ctcaccgcca acagcgaggt cgtcgagacc       420
     ggcgaggtca tgtgcttcac cggccgggac ttcttcatca ccgtccggca cggcgggcag       480
     ggctcgctgc gtgcgctgcg ccgccgcctc caggaggacc cggagctgct gctcaagggc       540
     ccctccgcgg tgctgcacgc catcgccgac cacgtcgtcg acggctacat cgcggtcgcc       600
     gacgcggtgc aggacgacat cgacgaggtc gagacggagg tgttctcgcc ggggcgcaag       660
     ggctccccgc gcggcacgga cgccgggcgg atctaccagc tcaagcgcga ggtgctggag       720
     ttcaagcggg cggtggcgcc gctgctgcgt cccatgcagc tgctcagcga gcggccgatg       780
     cggctggtcg acccggagat ccagaagtac ttccgggacg tggccgacca cgtggcccga       840
     gtgcaggagc aggtcatcgg gttcgacgaa ctgctgaact ccattctcca ggccaacctc       900
     gcccaggcgt ccgtggcgca gaacgaggac atgcgcaaga tcacctcgtg ggccgcgatc       960
     atcgccgtac ccacgatggt gtgcggggtc tacggcatga acttcgacta catgccggag      1020
     acgcactgga agttcggcta cccgctggtc ctgtcggtca cggtctgcat ctgtctgggc      1080
     atccaccgca ccctcaagcg caacggctgg ctctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page