(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5158

AL939122.SCO5158     Location/Qualifiers
FT   CDS_pept        235370..235966
FT                   /transl_table=11
FT                   /gene="SCO5158"
FT                   /gene_synonym="SCP8.21"
FT                   /product="hypothetical protein SCP8.21"
FT                   /note="SCP8.21, unknown, len: 198 aa"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK0"
FT                   /protein_id="CAC01359.1"
FT                   /translation="MADVLPLVEARLRSALGEPDARAAVTFLGTDRIEVLRFPAAGQEG
FT                   DVVRYATLGMSAQPMADPTAVLADPVKGPRAELVLSVRSGAADTDKVLRPLAVLAASPQ
FT                   VEGVIVAPGASLDVGEPLWPGAPFTSVLVAEPGGLVEDLELDAPLDPVRFLPLLPMTPN
FT                   EAAWKRVHGAPALQERWLNHGTDLRDPSRRSVPLD"
     atggctgatg ttcttcctct ggtcgaggcc cggttgcgca gtgcgctggg cgagccggac        60
     gcgcgcgcgg cggtcacctt cctcggcacc gaccgcatcg aggtgctgcg cttccccgcc       120
     gccggccagg agggcgacgt cgtccgctac gccaccctcg gcatgtcggc ccagcccatg       180
     gcggacccca cggccgtgct cgccgacccg gtcaagggcc cccgcgccga gctggtgctc       240
     tccgtgcgct ccggggccgc cgacaccgac aaggtgctgc gcccgctcgc cgtactggcc       300
     gcgtccccgc aggtcgaggg cgtgatcgtg gcgcccggcg cctcgctgga cgtcggtgag       360
     ccgctgtggc ccggggcccc gttcacctcg gtgctggtcg ccgagccggg gggtctggtc       420
     gaggacctgg agctggacgc cccgctggac ccggtgcggt tcctgccgct gctgccgatg       480
     acgccgaacg aggccgcctg gaagcgcgtg cacggcgcgc ccgccctcca ggagcgctgg       540
     ctgaaccacg ggacggacct gcgcgatccg tcccgcaggt ccgtccccct ggactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page