(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5159

AL939122.SCO5159     Location/Qualifiers
FT   CDS_pept        complement(236015..237238)
FT                   /transl_table=11
FT                   /gene="SCO5159"
FT                   /gene_synonym="SCP8.22c"
FT                   /product="putative integral membrane transport protein"
FT                   /note="SCP8.22c, possible integral membrane transport
FT                   protein, len: 407 aa; similar to TR:CAB76344
FT                   (EMBL:AL158061) Streptomyces coelicolor putative
FT                   multidrug-efflux transporter protein SC6D11.21, 577 aa;
FT                   fasta scores: opt: 1286 z-score: 1436.2 E(): 0; 51.1%
FT                   identity in 393 aa overlap and to SW:BMR1_BACSU
FT                   (EMBL:M33768) Bacillus subtilis multidrug resistance
FT                   protein 1 Bmr1, 389 aa; fasta scores: opt: 262 z-score:
FT                   298.0 E(): 3.9e-09; 22.9% identity in 375 aa overlap.
FT                   Contains Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter and possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9FBJ9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ9"
FT                   /protein_id="CAC01360.1"
FT                   /translation="MDPFDVGAGGILRQPKAVWATAGASVVAFMGIGLVDPILPSIAKG
FT                   LDASAGQVSLLFTSYFLITALAMLVTGFVSSRIGGRKTLLLGLAFVVVFAGLAGTSDTV
FT                   GQLVGYRAGWGLGNALFVSTALAVIVGAAAGGSAAAILLYESALGLGMACGPLLGALLG
FT                   DASWRYPFFGTAFLMAIGFLCITVFLKEQPRPARKTSLLDPIRALGHGGLASAAVSAFF
FT                   YNYTFFTVLAFTPFVLNMTPYKSGAVFFAWGVLLAVFSVLVAPRMQRRFGSLKVLGGSL
FT                   VLLAADVLVLGYGNHTAAIVCTILSGAFIGVNNTVYTELALGVSDAPRPVASAGYNFVR
FT                   WFAAAAAPYFAPKIEEWTDVHVPFVVAAVTALLGAVVVVVRRRALTHDAEELEPKHASE
FT                   DSVTVFAN"
     atggatccct tcgacgtggg tgcgggcggc atcctgcggc agcccaaggc cgtgtgggcg        60
     accgcgggcg cgtccgtcgt ggcgttcatg ggcatcgggc tggtcgaccc gatcctcccg       120
     tccatcgcca agggcctgga cgcgagcgcc gggcaggtct cgctcctgtt cacctcgtac       180
     ttcctcatca ccgccctggc catgctggtc accggcttcg tctccagccg catcggcggc       240
     cgcaagaccc tgctgctcgg cctggccttc gtcgtggtct tcgcgggcct cgccggcacc       300
     tccgacaccg tcggccagct cgtcggctac cgggccggct ggggcctggg caacgcgctg       360
     ttcgtctcga cggccctcgc ggtgatcgtc ggcgcggcgg ccggcggcag cgccgccgcg       420
     atcctgctct acgagtccgc cctcggtctc ggcatggcct gcggtccgct gctgggcgca       480
     ctgctcggcg acgccagctg gcgctacccg ttcttcggca cggccttcct gatggcgatc       540
     ggcttcctgt gcatcacggt gttcctcaag gagcagccgc ggccggcccg caagacctcg       600
     ctgctcgacc cgatcagggc gctgggccac ggtggcctcg cctccgccgc ggtctcggcg       660
     ttcttctaca actacacgtt cttcacggtg ctggccttca cgcccttcgt gctgaacatg       720
     acgccgtaca agtccggcgc cgtgttcttc gcgtggggcg tgctgctcgc cgtcttctcc       780
     gtgctggtgg caccgcgcat gcagcggcgc ttcggctcgc tcaaggtgct cggcggttcc       840
     ctggtcctgc tcgcggccga cgtcctggtc ctcgggtacg ggaaccacac cgcggcgatc       900
     gtctgcacga tcctgtccgg cgcgttcatc ggggtgaaca acaccgtcta caccgagctg       960
     gccctcgggg tctcggacgc gccgcgtccg gtggcgagcg cgggctacaa cttcgtgcgc      1020
     tggttcgccg cggcggccgc gccctacttc gcgccgaaga tcgaggagtg gaccgacgtc      1080
     cacgtcccgt tcgtggtggc ggcggtgacc gcgctgctcg gcgcggtcgt ggtggtcgta      1140
     cggcgccggg cgctgaccca cgacgccgag gagctggagc cgaagcacgc gagcgaggac      1200
     tcggtcacgg tcttcgccaa ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page