(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5160

AL939122.SCO5160     Location/Qualifiers
FT   CDS_pept        237430..238080
FT                   /transl_table=11
FT                   /gene="SCO5160"
FT                   /gene_synonym="SCP8.23"
FT                   /product="hypothetical protein SCP8.23"
FT                   /note="SCP8.23, unknown, len: 216 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ8"
FT                   /protein_id="CAC01361.1"
FT                   /translation="MRGEPSCPKCGGRVRAPGLFADSWQCDLHGTVHPVQPVLPPSVEA
FT                   LGVVVHRTQVPLWMPWPLPVGWLFTGVACAGDDRSGGRATAVACSGPGPLGGIGELILV
FT                   AEELGVGLGARYAGLDGPDPGPYLDVEKPPQVKVLAAGRPTPLWHVSGGPVDRAVFAGE
FT                   ALGMWLWAVVWPERSGLLMYEELVLTDLRDAGAEVDLVPCGALSPRLIEPTAP"
     atgaggggcg aacccagttg cccgaagtgt ggtggccggg tcagggctcc cggcctcttc        60
     gccgattcct ggcagtgcga cctgcacggc accgtgcacc cggtccagcc cgtacttccg       120
     cccagcgtcg aggcgctcgg cgtcgtggtg caccgcacac aggtgccgtt gtggatgccc       180
     tggccgctgc cggtcggctg gctgttcacc ggcgtggcct gtgcgggcga cgaccgcagc       240
     gggggccggg cgaccgccgt cgcctgttcc ggacccggtc cgctcggcgg catcggtgag       300
     ctgatcctgg tcgccgagga actcggcgtc ggcctcggcg cgcggtacgc gggcctcgac       360
     ggcccggacc ccgggccgta tctggacgtc gagaagccgc cccaggtcaa ggtcctggcc       420
     gcgggccgcc ccacccccct ctggcacgtc tccggcgggc ccgtcgaccg tgccgtcttc       480
     gccggggagg ccctcggcat gtggctgtgg gccgtggtgt ggcccgagcg gtccgggctg       540
     ctgatgtacg aggagctggt gctgaccgac ctgcgggacg ccggtgccga ggtggacctg       600
     gtgccgtgcg gggcgctgtc gccgcggctg atcgagccga cggcgccgta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page