(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5162

AL939122.SCO5162     Location/Qualifiers
FT   CDS_pept        239220..239825
FT                   /transl_table=11
FT                   /gene="SCO5162"
FT                   /gene_synonym="SCP8.25"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.25, possible integral membrane protein, len:
FT                   201 aa; similar to SW:YCHE_ECOLI (EMBL:AE000222)
FT                   Escherichia coli hypothetical 23.5 kD protein in AdhE-OppA
FT                   intergenic region YchE, 215 aa; fasta scores: opt: 406
FT                   z-score: 496.2 E(): 3.6e-20; 30.0% identity in 207 aa
FT                   overlap. Contains Pfam match to entry PF01914 UPF0056,
FT                   Uncharacterized protein family UPF0056 and possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBJ6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ6"
FT                   /protein_id="CAC01363.1"
FT                   /translation="MFDVAVFGSLFLTLFVIMDPPGITPIFLALTSGRPGKVQKRMALQ
FT                   AVCVAGGVITVFGLLGHQILDYLHVSVPALMIAGGLLLLLIALDLLTGKTDEPKQTKDV
FT                   NVALVPLGMPLLAGPGAIVSVILAVQKADSVTTQVSVWAAILAIHVVLWLVMRYSLLII
FT                   RVIKDGGVVLVTRLAGMMLSAIAVQQIINGVTQVIQGA"
     atgttcgacg tcgccgtctt cggctccctc ttcctgaccc tttttgtcat catggatccc        60
     cccgggatca ccccgatctt cctcgcgctc acctccggcc gccccggcaa ggtgcagaag       120
     cggatggccc tccaggccgt ctgcgtcgcc ggtggtgtga tcacggtgtt cggtctgctc       180
     gggcaccaga tcctggacta cctgcacgtg tccgtgcccg ccctgatgat cgcgggcggg       240
     ctgctgctcc tgctgatcgc cctcgacctg ctcaccggca agacggacga gccgaagcag       300
     accaaggacg tcaacgtcgc cctcgtaccg ctgggcatgc cgctgctcgc cgggcccgga       360
     gcgatcgtgt cggtcatcct ggccgtgcag aaggcggaca gcgtgaccac gcaggtctcg       420
     gtgtgggcgg cgatcctcgc catccacgtg gtgctgtggc tggtgatgcg gtactcgctg       480
     ctgatcatcc gggtcatcaa ggacggcggc gtggtcctgg tgacccgcct cgccggcatg       540
     atgctctccg cgatcgccgt gcagcagatc atcaacggcg tcacgcaggt gatccagggc       600
     gcgtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page