(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5164

AL939122.SCO5164     Location/Qualifiers
FT   CDS_pept        240280..241185
FT                   /transl_table=11
FT                   /gene="SCO5164"
FT                   /gene_synonym="SCP8.27"
FT                   /product="hypothetical protein"
FT                   /note="SCP8.27, hypothetical protein, len: 300 aa; similar
FT                   to N-terminal region of TR:Q9S2S7 (EMBL:AL096884)
FT                   Streptomyces coelicolor hypothetical 44.0 kD protein
FT                   SC4G6.31c, 403 aa; fasta scores: opt: 423 z-score: 494.8
FT                   E(): 4.3e-20; 36.5% identity in 230 aa overlap"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ4"
FT                   /protein_id="CAC01365.1"
FT                   /translation="MEAMNDDLAPLNARIDRTNELLQRMLAEVAKTPSTHAIFVDAGYL
FT                   YAAAGRLVAGTEDRRAFDLDAEGLIEALIDRARNIFADSRLLRVYWYDGARRRIHTAEQ
FT                   QSIAELPDVKVRLGNLNANNQQKGVDSLIRTDLESLARHRAISDAALLGGDEDLVSAVE
FT                   AAQGFGARVHLWGIEAPEGRNQAEPLLWEVDSQRTLDLDFFKPYVSRRTAPAAEATGLT
FT                   RPAREDVRFVGAQIAAKWLASRGRESLVELLPGHPYLPGSVDQDLLVEAEGLLQYSLRG
FT                   QADLRRALRDGFWEHLRAQY"
     atggaggcga tgaacgacga cctcgcgccc ctgaacgctc gtatcgatcg cacgaacgag        60
     ctgctccagc gcatgctcgc cgaggtggcg aagaccccct cgacccacgc gatcttcgtc       120
     gacgccggtt acctctacgc ggcggcgggg cggctggtgg ccgggaccga ggaccgccgg       180
     gccttcgacc tggacgccga ggggctcatc gaggccctca tcgacagggc ccggaacatc       240
     ttcgcggaca gccgcctgct gcgcgtctac tggtacgacg gcgcccgccg ccgcatccac       300
     accgccgagc agcagtccat cgccgagctg ccggacgtca aggtgcgcct gggcaacctc       360
     aacgccaaca accagcagaa gggcgtcgac tccctcatcc gcaccgacct ggagtccctc       420
     gcccggcacc gcgccatcag cgacgcggcc ctgctcggcg gcgacgagga cctcgtgtcg       480
     gcggtcgagg ccgcccaggg gttcggcgcc cgcgtccacc tgtggggcat cgaggccccc       540
     gagggtcgca accaggccga gccgctgctc tgggaggtcg acagccagcg caccctcgac       600
     ctcgacttct tcaagccgta cgtctcccgg cgcacggccc ccgccgccga ggcgacgggc       660
     ctcacccgcc cggcccggga ggacgtccgc ttcgtgggcg cccagatcgc ggcgaaatgg       720
     ctggcgtccc gggggcgcga gtccctcgtc gagctgctcc ccggccaccc ctacctcccc       780
     ggttccgtgg accaggacct gctggtggag gccgagggac tgctgcagta ctcgctgcgc       840
     ggccaggccg acctgcgccg ggccctgcgg gacggcttct gggagcacct gcgggcgcag       900
     tactag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page