(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5166

AL939122.SCO5166     Location/Qualifiers
FT   CDS_pept        complement(242300..244939)
FT                   /transl_table=11
FT                   /gene="SCO5166"
FT                   /gene_synonym="SCP8.29c"
FT                   /product="putative helicase"
FT                   /note="SCP8.29c, possible helicase, len: 879 aa; N-terminal
FT                   domain similar to SW:RHLE_ECOLI (EMBL:L02123) Escherichia
FT                   coli putative ATP-dependent RNA helicase RhlE, 454 aa;
FT                   fasta scores: opt: 884 z-score: 704.8 E(): 8.6e-32; 37.2%
FT                   identity in 444 aa overlap. Contains Pfam matches to
FT                   entries PF00270 DEAD, DEAD/DEAH box helicase and PF00271
FT                   helicase_C, Helicases conserved C-terminal domain and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00039 DEAD-box subfamily
FT                   ATP-dependent helicases signature. Also contains three sets
FT                   of different repeats: 10x RU1: RRTRK, 4x RU2:AAAKAEAAA and
FT                   4x RU3:AAEPA"
FT                   /db_xref="GOA:Q9FBJ2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ2"
FT                   /protein_id="CAC01367.1"
FT                   /translation="MTLPVALSGKDVIGQAKTGTGKTLGFGLPLLERVTVPADVEAGRA
FT                   APESLTDAPQALVVVPTRELCQQVTNDLLTAGKVRNVRVLAIYGGRAYEPQVEALKQGV
FT                   DVIVGTPGRLLDLAGQNKLSLKHIKSLVLDEADEMLDLGFLPDVEKIINMLPARRQTML
FT                   FSATMPGAVIGLARRYMSQPTHISATSPDDEGATVANTKQFIYRAHNMDKPEMVARILQ
FT                   ADGRGLAMVFCRTKRTAADLADQLKQRGFASGAVHGDLGQGAREQALRAFRNGKVDVLV
FT                   CTDVAARGIDVEGVTHVINYQSPEEEKTYLHRIGRTGRAGAKGTAITLVDWDDIPRWQL
FT                   INKALDLGFNDPPETYSTSPHLYTDLGIAEGTKGVLPRSERTRAGLDAEELEDLGEPGG
FT                   RGGRGRGDRGDRGGRGGRDDSRSGDRERDRSSRTTPRRRRRMRGGAPVDAEASVAPAAE
FT                   TVTVTDGAAGATDAGTDTDKAPRTLRRRRRTRSGEPSRRQETAATLGTDGPAAQAAEDA
FT                   ALAPSEAPVVETVAAEPVAAPEAVEAPAKPRRRTRTRKAAETPAAPLETAPTAAPTATE
FT                   ESIVAPAVVETPTVEAPAEKPRRRTRKATAAEATVETAEGAAEPAPEPAETKPRRRTRK
FT                   AAEPAAQAPDAEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAE
FT                   PAVQAAPEGEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAEPA
FT                   VQAAPEGEAETEAKPRRTRKTTATKTAAAKAEAAAKAEAAADTAEAAEAKPKARRARKT
FT                   AAAVEATAEIPAQASQEPEAAPRRRTRKAAVAVEAPAAGADTAEAKPKARRTRKTAAAA
FT                   QPAEAGES"
     atgacgctcc ccgtagccct gtcgggcaag gacgtcatcg gccaggccaa gaccggcacc        60
     ggcaagacgc tgggcttcgg cctcccgctc ctcgagcgcg tcaccgtccc cgccgacgtc       120
     gaggcgggcc gcgcggcgcc cgagtccctg accgacgccc cgcaggccct cgtcgtcgtc       180
     ccgacgcgcg agctgtgcca gcaggtcacc aacgacctcc tgaccgccgg caaggtccgc       240
     aacgtacgcg tcctcgcgat ctacggcggc cgcgcctacg agccgcaggt ggaggcgctg       300
     aagcagggcg tcgacgtgat cgtcggcacc ccgggccgcc tgctggacct ggcgggccag       360
     aacaagctga gcctgaagca catcaagagc ctggtcctcg acgaggccga cgagatgctc       420
     gacctgggct tcctgcccga cgtcgagaag atcatcaaca tgctgccggc caggcgccag       480
     accatgctgt tctcggcgac gatgccgggc gcggtcatcg gactggcccg ccgttacatg       540
     tcgcagccca cgcacatctc cgccacctcg ccggacgacg agggcgcgac ggtcgcgaac       600
     acgaagcagt tcatctaccg cgcgcacaac atggacaagc ccgagatggt ggcgcgcata       660
     ctgcaggccg acggccgtgg actggccatg gtcttctgcc gcaccaagcg caccgcggcc       720
     gacctggccg accagctcaa gcagcgcggc ttcgcctccg gcgcggtcca cggcgacctc       780
     ggccagggcg cccgcgagca ggccctgcgc gccttccgca acggcaaggt ggacgtgctc       840
     gtctgcaccg acgtcgccgc ccgcggcatc gacgtcgagg gcgtgacgca cgtcatcaac       900
     taccagtcgc cggaagagga gaagacgtac ctgcaccgca tcggccgcac cggccgcgcg       960
     ggcgcgaagg gtacggcgat cacgctggtc gactgggacg acatcccgcg ctggcagctg      1020
     atcaacaagg cgctggacct gggcttcaac gacccgccgg agacgtactc cacctccccg      1080
     cacctgtaca ccgacctggg catcgccgag ggcaccaagg gcgtcctgcc gcgctcggag      1140
     cgcacccgcg ccgggctcga cgcggaggag ctcgaggacc tgggcgagcc gggcggccgc      1200
     ggtggccgcg ggcgcggcga ccggggcgac cggggcggcc ggggtgggcg cgacgactca      1260
     cgttccggcg atcgcgagcg cgaccgttcg tcccgtacga cgccgcgccg ccgccgtcgg      1320
     atgcgcggcg gtgcgccggt ggacgcggag gcctccgtgg cccccgcggc cgagaccgtg      1380
     accgtgaccg atggtgcggc cggcgccacc gacgcgggca ccgacaccga caaggccccc      1440
     cgcacgctgc gccgccggcg ccgtacgcgg agcggcgagc cctcgcgccg ccaggagacc      1500
     gccgcgacgc tcggcaccga cggcccggcg gcgcaggccg ccgaggacgc cgcgctcgcg      1560
     ccttccgagg ctccggtcgt ggaaacggtg gcggccgaac cggtggcggc cccggaggcc      1620
     gtggaggccc cggcgaagcc gcgccgacgc acccgcaccc gcaaggcggc cgagaccccg      1680
     gccgccccgc tggagaccgc tccgacggcg gcgccgacgg ccaccgagga gtcgatcgtg      1740
     gctccggcgg tcgtcgagac cccgacggtg gaggctcccg ccgagaagcc tcgccggcgc      1800
     acccgcaagg ccacggccgc cgaggcgacg gtcgagacgg ccgagggagc ggccgagccc      1860
     gcgcccgagc cggccgagac caagccgcgc cgccgtaccc gcaaggctgc cgagcccgcc      1920
     gcgcaggctc cggacgccga ggcggaggcc gaggccaagc cgcgccgcac ccgcaagacg      1980
     acggccacca agacggccgc cgccaaggcc gaagccgccg ccgacaccgc cgaggcggca      2040
     gaggcgaagc ccaaggcccg ccgcacccgc aaggccgccg aaccggcggt gcaggccgct      2100
     ccggagggcg aggcggaggc cgaggccaag ccgcgccgca cccgcaagac gacggccacc      2160
     aagacggccg ccgccaaggc cgaagccgcc gccgacaccg ccgaggcagc agaggcgaag      2220
     cccaaggccc gccgcacccg caaggccgcc gaaccggcgg tgcaggccgc tccggagggc      2280
     gaggcggaga ccgaggccaa gccgcgccgc acccgcaaga cgacggccac caagacggcc      2340
     gccgccaagg ccgaagccgc cgccaaggcc gaagccgccg ccgacacagc cgaggcggca      2400
     gaggcgaagc ccaaggcccg ccgcgcccgg aagacggccg cggccgtcga ggccaccgcc      2460
     gagattccgg cgcaggcctc gcaggagccg gaggccgcgc cgcggcgccg gacccgtaag      2520
     gccgcggttg ccgtcgaggc gcccgcggcg ggagccgaca cggcggaggc gaagccgaag      2580
     gcccgccgca cccgcaagac ggccgccgcc gcgcagcccg cggaggcagg cgagagctga      2640
//

If you have problems or comments...

PBIL Back to PBIL home page