(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5167

AL939122.SCO5167     Location/Qualifiers
FT   CDS_pept        245432..246214
FT                   /transl_table=11
FT                   /gene="SCO5167"
FT                   /gene_synonym="SCP8.30"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.30, conserved hypothetical protein, len: 260
FT                   aa; similar to TR:O05856 (EMBL:Z95120) Mycobacterium
FT                   tuberculosis hypothetical 25.1 kD protein MTCY07D11.16, 231
FT                   aa; fasta scores: opt: 599 z-score: 647.2 E(): 1.4e-28;
FT                   42.5% identity in 233 aa overlap. Contains 4x degenerate
FT                   repeat:T(G/A)G"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ1"
FT                   /protein_id="CAC01368.1"
FT                   /translation="MTSSDKPGTAADAPAETAGTAGTAGTGGATPVAARDWAAAAADPQ
FT                   YRAAVVDLLGALAYGELAAFERLAEDAKLAPTLADKAELAKMASAEFHHFERLRDRLAE
FT                   IGEEPTGAMEPFVAAYDGFHKQTDPSDWLEGLVKAYVGDSIASDFYREVAARLDTDTRE
FT                   LVLAVLDDTGHAGFAVEKVRAAIDADPRVGGRLALWARRLMGEALSQSQRVVADRDALS
FT                   TMLVGGVADGFDLAEVGKMFSRITEAHTKRMAALGLAA"
     atgacgagct ctgacaagcc tggcaccgcc gcagacgccc ccgccgagac cgctggaacc        60
     gccggtaccg ccggtaccgg cggagccacc ccggtcgccg cccgcgactg ggcggcggcc       120
     gcggccgacc cgcagtaccg cgccgcggtc gtggacctgc tcggcgcgct cgcgtacggc       180
     gagctggcgg cgttcgagcg gctcgcggag gacgccaagc tggcgccgac gctggcggac       240
     aaggcggagc tggcgaagat ggcgtcggcg gagttccacc acttcgagcg gctgcgcgac       300
     cggctggccg agatcggcga ggagccgacg ggggccatgg agccgttcgt ggccgcctac       360
     gacggcttcc acaagcagac ggacccctcg gactggctgg agggtctcgt caaggcctac       420
     gtcggcgact ccatcgccag cgacttctac cgcgaggtcg ccgcccgcct cgacacggac       480
     acccgcgagc tggtcctcgc cgtgctcgac gacaccgggc acgccggttt cgccgtggag       540
     aaggtgcgcg cggcgatcga cgccgacccg cgcgtgggcg ggcggctcgc gctgtgggcg       600
     cggcggctga tgggggaggc gctctcgcag tcccagcggg tggtggccga ccgggacgcg       660
     ctgtcgacca tgctcgtggg cggggtcgcg gacggcttcg acctggccga ggtgggcaag       720
     atgttctccc ggatcaccga ggcgcacacc aagcggatgg cggcgctggg tctggcggcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page