(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5168

AL939122.SCO5168     Location/Qualifiers
FT   CDS_pept        complement(246330..246599)
FT                   /transl_table=11
FT                   /gene="SCO5168"
FT                   /gene_synonym="SCP8.31c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.31c, possible integral membrane protein, len:
FT                   89 aa. Contains possible hydrophobic membrane spanning
FT                   regions. Also high content in alanine and leucine amino
FT                   acid residues"
FT                   /db_xref="GOA:Q9FBJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ0"
FT                   /protein_id="CAC01369.1"
FT                   /translation="MFLEALSAALLGLALAWAAAHRLPHRLPAPLLVLPTGVAGALFGA
FT                   FVTHTALGAGGLVPVLLGSATVSAASLSLLLRPAGRLRRSSATA"
     atgttcttgg aagcgctcag cgccgcactt ctcggcctcg ccctggcatg ggcggccgcg        60
     caccgtctgc cccaccgcct gcccgccccg ctcctcgtcc tgccgaccgg tgtcgccggg       120
     gccctcttcg gggcgttcgt cacgcacacc gcgctgggtg ccggggggct cgtgccggtg       180
     ctgctgggtt cggcgacggt ctccgcggcc tcgctgtcgc tgctgctgcg ccccgcggga       240
     aggctccgcc gcagttcggc gaccgcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page