(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5170

AL939122.SCO5170     Location/Qualifiers
FT   CDS_pept        complement(247213..247854)
FT                   /transl_table=11
FT                   /gene="SCO5170"
FT                   /gene_synonym="SCP8.33c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCP8.33c, probable tetR-family transcriptional
FT                   regulator, len: 213 aa; similar to TR:O53661
FT                   (EMBL:AL021929) Mycobacterium tuberculosis putative
FT                   regulatory protein MTV034.04, 204 aa; fasta scores: opt:
FT                   309 z-score: 383.4 E(): 6.9e-14; 31.3% identity in 201 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 42..63 (+3.37 SD)"
FT                   /db_xref="GOA:Q9FBI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI8"
FT                   /protein_id="CAC01371.1"
FT                   /translation="MTAIEQTEAVRPRGTRLPRRARRNQLLGAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKLDLYLALLDQHCEALIQSVRSALASTSDNKQRVRATMDA
FT                   YFAYVEDDGGAFRLVFESDLTNEPAVRERVDKVTNECAEAICDVIAEDTGLSRAESMLL
FT                   ASGLGGLAQVVARSWLHSDRSVPRDQAVQLLTSLAWRGIAGFPLHGIEQH"
     gtgacagcca tcgagcagac agaggcggta cgcccgcggg gcacacgcct tccccgccga        60
     gcccgacgca accagctgct gggcgccgca caggaagtgt tcgtggccca gggctaccac       120
     gcggccgcga tggacgacat cgccgagcga gccggcgtca gcaagccggt gctctaccag       180
     cacttccccg gcaagctcga cctctacctc gccctgctgg accagcactg cgaggcactg       240
     atccagtccg tgcgcagcgc gctggcgtcg acctccgaca acaagcagcg cgtccgggcg       300
     acgatggacg cgtacttcgc ctacgtcgag gacgacggcg gtgccttccg cctggtcttc       360
     gagtcggacc tgaccaacga gcccgccgtg cgcgagcgcg tggacaaggt gacgaacgag       420
     tgcgcggagg cgatctgcga cgtcatcgcc gaggacaccg gcctctcgcg cgcggagtcg       480
     atgctgctgg cctcgggact gggcggtctc gcgcaggtgg tggcgcgctc ttggctgcac       540
     agcgaccgca gcgtgccccg cgaccaggcg gtgcagctgc tgacctcgct ggcctggcgg       600
     ggcatcgccg gcttcccgct gcacggcatc gagcagcact ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page