(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5171

AL939122.SCO5171     Location/Qualifiers
FT   CDS_pept        complement(248029..248256)
FT                   /transl_table=11
FT                   /gene="SCO5171"
FT                   /gene_synonym="SCP8.34c"
FT                   /product="hypothetical protein SCP8.34c"
FT                   /note="SCP8.34c, unknown, len: 75 aa. Highly hydrophilic"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KIL8"
FT                   /protein_id="CAC01372.1"
FT                   /translation="MTVDPTDPETFDDEAQAPDPEDRDVEAPDADAAEQRADVGQERDA
FT                   PLTGVEPDRADEADLAEQARVVPHDEDDYR"
     atgaccgtcg acccgaccga ccccgagacc ttcgacgacg aggcgcaggc accggatccg        60
     gaggaccgcg acgtcgaggc gcccgacgcc gacgccgccg agcagcgggc ggacgtcggg       120
     caggagcgcg acgcgccgct gaccggcgta gagccggacc gcgccgacga ggccgacctg       180
     gccgagcagg cccgggtcgt cccgcacgac gaggacgact accgctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page