(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5173

AL939122.SCO5173     Location/Qualifiers
FT   CDS_pept        249569..251248
FT                   /transl_table=11
FT                   /gene="SCO5173"
FT                   /gene_synonym="SCP8.36"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.36, hypothetical protein, len: 559 aa; low
FT                   similarity to TR:Q9XAG2 (EMBL:AL079356) Streptomyces
FT                   coelicolor possible membrane protein SC6G9.20, 303 aa;
FT                   fasta scores: opt: 452 z-score: 362.9 E(): 9.5e-13; 34.1%
FT                   identity in 258 aa overlap"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI6"
FT                   /protein_id="CAC01374.1"
FT                   /translation="MGRHSRRGPAPKADAADTAAARENRAGRPDPRRTNGPSQEPQGPY
FT                   QPQGPHQSQRPHQPQGVEGAAPPGAAPGDVPGARQGYAGPSPGRGPGARLPDGETSAHG
FT                   FPRTADGTPAGGVPGYPDGTPAHGVPRYPDGTPAHGVPRFSDGTPAHGVPRVRGGHPEQ
FT                   REPGGGWGEPAGRPGAGYGSVSGPRNGAPESFAPPSPSGPASAFPRQRQAPAEGPRQDY
FT                   LDAFRADDDVFAVRPRGRIPGAARPADPYASVTDWSAEDGGASGGGGIPGGAEADADDE
FT                   PPTGEPAPAKGAKGRTFTGIAAAAVTTVLAVVVAGQVADGSDGSDMRAQSATDQARGAH
FT                   DPASRDDERPTPAASASAKPLTYEQKMGRTYPLGATLKASGKFDAVPGIAKGTGKGQKY
FT                   TYRIDVEQGLGLDGGLFAEAVQKTLNDDRSWAHNGARTFERVESGQPDFVITLASPGTT
FT                   AEWCAKSGLDTTEDNVSCDSAATQRVMINAYRWAQGAAPYGDAIHAYRQMLINHEVGHR
FT                   IGYNHVTCDKDGELAPVMQQQTKFVDHDGIDCRPNAWAYPNG"
     gtgggacgcc acagccgccg cgggcccgct cccaaggcag acgccgcgga caccgccgca        60
     gcacgtgaga accgggccgg ccggcccgac ccgcgtcgga cgaacgggcc gtcgcaggag       120
     ccacaggggc cgtaccagcc gcagggacct catcagtcac agcggcccca ccagccacag       180
     ggggtcgagg gggcggcacc acccggggcg gctccgggcg acgtcccggg tgcccgccag       240
     gggtacgcgg gccccagccc ggggcggggt ccgggggcgc gactccccga cggcgagacg       300
     tcggcccacg gtttcccgcg gacggcggac ggcacgcccg cggggggcgt ccccggatac       360
     cccgacggca ctccggcgca cggcgtcccc aggtatcccg acggcactcc ggcgcacggt       420
     gtgcccaggt tctccgacgg caccccggcg cacggtgtgc cgcgggtccg gggcggtcac       480
     cccgagcagc gggaacccgg cggaggctgg ggcgagccgg ccgggcggcc cggtgccggg       540
     tacggatcgg tgtcgggacc gcgcaacggg gcccccgagt ccttcgcgcc gccctcgccc       600
     tccggaccgg cctcggcctt cccgaggcag cggcaggcgc cggcggaggg gccgcggcag       660
     gactacctgg acgccttccg cgcggacgac gacgtcttcg cggtccgccc ccgcggccgt       720
     atccccggtg cggcccggcc cgccgacccg tacgcctccg tcaccgactg gagcgccgaa       780
     gacgggggcg cctccggagg cggcggcatc cccggcggtg ccgaggcgga cgccgacgac       840
     gagccgccca cgggcgaacc cgcaccggcc aagggagcca agggccggac cttcaccggt       900
     atcgcggcgg ccgccgtcac caccgtgctg gccgtcgtcg tggccggtca ggtcgctgac       960
     gggtcggacg ggagcgacat gcgcgcgcag tccgccaccg accaggcccg cggtgcccac      1020
     gacccggcgt cacgggacga cgaacggccg acgcccgccg cgtccgcctc cgcgaaaccg      1080
     ctgacgtacg agcagaagat gggcaggacc tacccgctgg gtgccaccct caaggcctcg      1140
     gggaagttcg acgcggtccc gggcatcgcc aaggggaccg ggaaggggca gaagtacacc      1200
     taccgcatcg acgtggagca ggggctcggc ctcgacggcg gactcttcgc ggaggccgtg      1260
     cagaagaccc tcaacgacga ccggagctgg gcccacaacg gcgcccgcac cttcgagcgc      1320
     gtcgaatcgg gtcagccgga cttcgtcatc acgctggcca gccccggtac caccgccgag      1380
     tggtgcgcca agtcgggcct ggacaccacc gaggacaacg tctcctgcga ctcggccgcc      1440
     acccagcgcg tgatgatcaa tgcctatcgc tgggcccagg gcgccgcgcc gtacggcgac      1500
     gcgatccacg cgtaccggca gatgctgatc aaccacgagg tcggtcaccg catcggctac      1560
     aaccacgtga cctgcgacaa ggacggcgaa ctcgccccgg tcatgcaaca gcagacgaaa      1620
     ttcgtcgacc acgacggaat cgactgccgc cccaacgcct gggcctatcc gaacggctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page