(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5174

AL939122.SCO5174     Location/Qualifiers
FT   CDS_pept        251463..253244
FT                   /transl_table=11
FT                   /gene="SCO5174"
FT                   /gene_synonym="SCP8.37"
FT                   /product="putative transferase"
FT                   /note="SCP8.37, possible transferase, len: 593 aa;
FT                   C-terminal region similar to TR:CAB92272 (EMBL:AL356595)
FT                   Streptomyces coelicolor putative transferase SCC61A.27, 436
FT                   aa; fasta scores: opt: 233 z-score: 251.3 E(): 1.6e-06;
FT                   29.9% identity in 462 aa overlap. Contains Pfam match to
FT                   entry PF00534 Glycos_transf_1, Glycosyl transferases group
FT                   1. Also contains 3x conserved repeat unit: ARSSE"
FT                   /db_xref="GOA:Q9FBI5"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI5"
FT                   /protein_id="CAC01375.1"
FT                   /translation="MRIGLLTEGGYPYVSGEAGLWCDRLVRGLEHHEFDVYALSRSERE
FT                   EDGGWVPLPPQVGRVRTAPLWETVDDGIVHGRRARRRFAECYGELATALCAAAPGDPAR
FT                   SSEARSSEARSSEGEPEGQSALEADRFASALYGLAELARDEGGLPTALRSETAVRALER
FT                   ACRAPGAHRSAREARVPDLLAVAARLERALRPLSLDWYEDDDLGSVDLCHAASGGTGAL
FT                   PGLLARHFCDVPLLVTEYGVRLRTHYLTEPDSSPAIRSLLAAFHGRLAAETYRRAAVIT
FT                   PGNTHTRRWQERCGADRAKLRTVHPGMDAAPFAEAGESPECADPQTLVWVGRVEPAKDL
FT                   VSLLHAFAEVRRAEPGSRLRIVGAPFGPEGVAYLAHCKGLAAQLFPDEADGPHAVGRNP
FT                   VSFEETGGPELPSRADAYASGALVVLSSVVEGFPTGLVEAMFCGRATVSTDVGAVVEAI
FT                   GGTGLVVPPRNPRALAEACVALLRDPERRERLGAAARARALELFTVEQNITAFHGIYLE
FT                   ILSRAPVRRVVLDGAGEPLPFGVPAEAHVPGRWSDATARAAARGGPGAVRTGPGWATGG
FT                   GPVRATTAVSAAEGASR"
     gtgcgcatcg gactgcttac ggagggtggc tatccgtatg tgagcggtga ggccgggctc        60
     tggtgcgacc ggctcgtgcg cggcctggag caccatgagt tcgacgtcta cgcgctcagc       120
     cgcagcgagc gcgaggagga cgggggctgg gtgccgctgc cgccgcaggt cggccgggtg       180
     cgcaccgccc cgctgtggga aaccgtggac gacggaatcg tccacggacg gcgcgcgcgc       240
     cggcgcttcg ccgagtgcta cggcgagttg gccacggccc tgtgcgcggc cgcccccggg       300
     gatccggcca ggagttcgga ggccaggagt tcggaggccc ggagctcgga gggggagccg       360
     gaagggcagt cggcccttga ggcggaccgt ttcgccagtg cgctgtacgg cctcgccgaa       420
     ctcgcccggg acgagggcgg actgcccacc gcgctccgct cggagaccgc cgtacgcgcc       480
     ctggagcgcg cctgtcgcgc gcccggcgcc caccgctccg cgcgcgaggc gcgcgttccc       540
     gatctactgg ccgtcgccgc gcgcctcgaa cgcgccctgc gccccctgtc cctcgactgg       600
     tacgaggacg acgacctcgg ttcggtggac ctgtgccacg cggcctccgg aggcacgggc       660
     gccctcccgg gcctgctcgc ccggcacttc tgcgacgtgc cgctgctcgt gaccgagtac       720
     ggcgtgcggc tgcggacgca ctacctcacg gaacccgatt cctcgcccgc gatacggtcg       780
     ctgctcgccg ccttccacgg tcggctggcc gccgagacct accggcgcgc ggccgtgatc       840
     accccgggca acacccacac ccgtcgctgg caggagcgct gcggcgccga ccgagccaaa       900
     ctgcgcacgg tccacccggg catggacgcg gctcccttcg cggaggcggg ggagtccccg       960
     gagtgcgccg acccgcagac cctcgtctgg gtcgggcgcg tcgaaccggc caaggacctg      1020
     gtctcgctgc tgcacgcctt cgcggaggtc cgcagggcgg agcccggctc gcggctcagg      1080
     atcgtcggtg cccccttcgg ccccgagggc gtcgcctacc tggcccactg caagggactg      1140
     gcggcgcagc tcttcccgga cgaggccgac ggtccgcacg ccgtgggccg caacccggtc      1200
     tccttcgagg agaccggcgg ccccgaactg ccctcccgcg ccgacgccta cgcctcgggg      1260
     gccctggtgg tgctctccag cgtcgtcgaa gggttcccga ccgggctcgt cgaggccatg      1320
     ttctgcggcc gggcgacggt gtccacggac gtcggcgcgg tggtggaggc catcggcggc      1380
     accggactcg tcgtgccccc gcgcaatccg cgggcgctcg ccgaggcgtg cgtcgcgctg      1440
     ttgcgcgacc ccgagcgccg cgaacgcctg ggcgccgccg cacgcgcccg cgcactggaa      1500
     ctgttcaccg tcgagcagaa catcacggca tttcacggca tttacctgga gatcctctct      1560
     cgtgcaccgg tacgccgcgt cgtcctcgac ggcgccggcg aacccctgcc cttcggtgtc      1620
     cccgccgagg cccacgtccc cggtcgctgg agcgacgcca cggcccgggc cgctgcccgg      1680
     ggcggtcccg gcgcggtccg gaccggtccc gggtgggcga cgggcggcgg cccggtccgg      1740
     gccacgacag cggtttcggc ggccgaggga gcgtcccgat ga                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page